[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54870.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:269 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->84 2w82B PDBj 1e-06 46.9 %
:RPS:PFM   14->147 PF07275 * ArdA 5e-09 41.8 %
:HMM:PFM   12->200 PF07275 * ArdA 4.5e-14 28.8 160/169  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54870.1 GT:GENE ACV54870.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1096059..1096868) GB:FROM 1096059 GB:TO 1096868 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54870.1 GB:DB_XREF GI:257474550 LENGTH 269 SQ:AASEQ MANNDFRDGFDVCVGNWGYYSEGELRDTWMHLPIDPDKIEPWLRSHGLVDAEHEETYISDYDGLPFRCPQVFDEYGRLDKLNVLAMQLTLLPEGDLAHIQAAIDYGEPLDHLDELMNLVAQADELPVFDYLYDDMYVEDQWHKTCLERSTPQENYAYTVLNDDSEFWNLMNRGDGELLSCFDFNRYGEIAVNNGYVDLCETCYVNKGGDWPLLDEYSFEEIGGETVAEWRGRVAQEKPAAPSEIAYAASALAALSADDGAGGTARAAKL GT:EXON 1|1-269:0| SEG 239->267|aapseiayaasalaalsaddgaggtaraa| BL:PDB:NREP 1 BL:PDB:REP 12->84|2w82B|1e-06|46.9|64/162| RP:PFM:NREP 1 RP:PFM:REP 14->147|PF07275|5e-09|41.8|122/167|ArdA| HM:PFM:NREP 1 HM:PFM:REP 12->200|PF07275|4.5e-14|28.8|160/169|ArdA| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 64 STR:RPRED 23.8 SQ:SECSTR ###########EEEEEHHHHTTTcccEEEEEccccHHHHHHHH###TccT#TcccEEEEEEE#ccc####cccTTccHHHHHHH######################################################################################################################################################################################### DISOP:02AL 269-270| PSIPRED cccccccccccEEEEEcccccccEEEEEEEcccccHHHHHHHHHccccccHHHHHHHHccccccccccccEEcccccHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHccHHccccccccccccccccccHHHHEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccHHccc //