[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54878.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:371 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->93 PF10969 * DUF2771 0.00037 28.2 71/161  
:BLT:SWISS 300->366 ZNF19_PONAB 8e-04 22.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54878.1 GT:GENE ACV54878.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1104405..1105520) GB:FROM 1104405 GB:TO 1105520 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: YALI0C11165p GB:PROTEIN_ID ACV54878.1 GB:DB_XREF GI:257474558 LENGTH 371 SQ:AASEQ MKNNPIDKIRDLLAEPAARRKAVICAGVVAVLAIGGAGIVIASNRPEPIDSSPSAVEKAGAESVAPADIAKICPTLTLDGQDVGAPADEVTVTTGKGRVFVTQRADDDAAATVDSTARRSAALARSLDGCETGGKTIETVTWAAVDEGGNVQVAVTNSPAAAPSGGTTAEVVNGSGGHVISDGVWNSDGVHDAGYEQNAGTVTDSAGGKIEAGAAPKADEGDKSETAEDGSAKADDSGAKADTKSDTKKNDSKGNAATQASGGSSSSSSASGSAQSQKKWVPEQGHWETDYGQVWVPNVVYVRHGRFICNACGATFDSKNGFYAHSDAMYAQGQNHDGYTDDSYTTSEDQGHYEQQATGRHWVVDVAGHWE GT:EXON 1|1-371:0| BL:SWS:NREP 1 BL:SWS:REP 300->366|ZNF19_PONAB|8e-04|22.4|67/100| TM:NTM 1 TM:REGION 22->44| SEG 22->42|avicagvvavlaiggagivia| SEG 104->127|radddaaatvdstarrsaalarsl| SEG 227->255|aedgsakaddsgakadtksdtkkndskgn| SEG 259->277|qasggssssssasgsaqsq| HM:PFM:NREP 1 HM:PFM:REP 19->93|PF10969|0.00037|28.2|71/161|DUF2771| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,25-25,59-60,62-62,66-67,71-71,73-73| PSIPRED ccccHHHHHHHHHHcHHHHccHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHcccccccHHHHHHHcccEEEcccccccccccEEEEccccEEEEccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEEccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccHHHHHHHcccccccccccccccccccccHHHHHHHHccccccccccccccccHHHHHcccccccccccccccccccEEEEEcccEEEcccccEEcccccEEEccccHHHcccccccccccccccHHHHcHHHccccccEEEEEEccccc //