[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54883.1
DDBJ      :             plasmid maintenance system antidote protein, XRE family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:106 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   29->87 3dnvB PDBj 1e-09 18.6 %
:RPS:SCOP  29->92 2auwA1  a.35.1.10 * 9e-10 9.4 %
:HMM:SCOP  21->87 2a6cA1 a.35.1.13 * 1.7e-10 35.8 %
:RPS:PFM   38->85 PF01381 * HTH_3 5e-06 43.8 %
:HMM:PFM   31->85 PF01381 * HTH_3 1.8e-11 36.4 55/55  
:BLT:SWISS 29->102 RGHRB_BACSU 5e-05 35.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54883.1 GT:GENE ACV54883.1 GT:PRODUCT plasmid maintenance system antidote protein, XRE family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1112994..1113314) GB:FROM 1112994 GB:TO 1113314 GB:DIRECTION - GB:PRODUCT plasmid maintenance system antidote protein, XRE family GB:NOTE PFAM: helix-turn-helix domain protein; SMART: helix-turn-helix domain protein; KEGG: plu:plu3590 hypothetical protein GB:PROTEIN_ID ACV54883.1 GB:DB_XREF GI:257474563 InterPro:IPR001387 LENGTH 106 SQ:AASEQ MAAVTRDGDGCVPLAELDINPALRATCQRRLAAALEGRAMTARKLAEFSGVSEAVISRTLHGQRTPTLDAIVRLSLTLNVSADYLLGLKASPQGDYRDASQGGAGA GT:EXON 1|1-106:0| BL:SWS:NREP 1 BL:SWS:REP 29->102|RGHRB_BACSU|5e-05|35.6|73/139| RP:PDB:NREP 1 RP:PDB:REP 29->87|3dnvB|1e-09|18.6|59/71| RP:PFM:NREP 1 RP:PFM:REP 38->85|PF01381|5e-06|43.8|48/55|HTH_3| HM:PFM:NREP 1 HM:PFM:REP 31->85|PF01381|1.8e-11|36.4|55/55|HTH_3| GO:PFM:NREP 1 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 1 RP:SCP:REP 29->92|2auwA1|9e-10|9.4|64/67|a.35.1.10| HM:SCP:REP 21->87|2a6cA1|1.7e-10|35.8|67/0|a.35.1.13|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 86 STR:RPRED 81.1 SQ:SECSTR ###################HHHHHHHHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHcGGGccHHHHHHHHHHTTccccccccHHHHHcccHHHccccccc# DISOP:02AL 8-20,106-107| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHccccccccccccHHHHcccc //