[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54896.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:56 amino acids
:PSIPRED
:HMM:PFM   21->53 PF11095 * Gemin7 0.0002 30.3 33/80  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54896.1 GT:GENE ACV54896.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1128331..1128501 GB:FROM 1128331 GB:TO 1128501 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54896.1 GB:DB_XREF GI:257474576 LENGTH 56 SQ:AASEQ MNMVTAFTEVGDPRAGGRKKDESALRWRKMRAYYDMMGPAKQRTLLDVARAMAEDF GT:EXON 1|1-56:0| HM:PFM:NREP 1 HM:PFM:REP 21->53|PF11095|0.0002|30.3|33/80|Gemin7| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcc //