[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54906.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:141 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   51->131 PF07889 * DUF1664 0.00044 26.4 72/126  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54906.1 GT:GENE ACV54906.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1139649..1140074) GB:FROM 1139649 GB:TO 1140074 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54906.1 GB:DB_XREF GI:257474586 LENGTH 141 SQ:AASEQ MAKKTHMVTCRLDDRDYGSLHENAAALDVAPSTYMRYLIRIPVSACQDPKGANVLVVDAKTLGALRYELVRWGRHYNQGVHALNAIAYAARKKAPGRDYFVQQIGIANEKLDAVEEGRRRLEGRLDDLEGSIVVGGGPCRY GT:EXON 1|1-141:0| SEG 115->130|eegrrrlegrlddleg| HM:PFM:NREP 1 HM:PFM:REP 51->131|PF07889|0.00044|26.4|72/126|DUF1664| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 39-39,67-67,81-81,87-87,90-90,95-95,101-102,104-104,109-109,123-123,129-130,132-132| PSIPRED cccccEEEEEEEccccccHHHcccccEEccHHHHHHHHHHccHHHcccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHHHccHHcccccEEEccccccc //