[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54933.1
DDBJ      :             ribosomal protein S10
Swiss-Prot:             

Homologs  Archaea  57/68 : Bacteria  901/915 : Eukaryota  38/199 : Viruses  0/175   --->[See Alignment]
d.58.15
:102 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->102 1vs5J PDBj 3e-34 61.2 %
:RPS:PDB   4->102 3bbnJ PDBj 6e-35 59.6 %
:RPS:SCOP  5->101 1fjgJ  d.58.15.1 * 4e-33 56.7 %
:HMM:SCOP  5->102 1fjgJ_ d.58.15.1 * 3.9e-36 62.2 %
:RPS:PFM   6->102 PF00338 * Ribosomal_S10 6e-33 72.2 %
:HMM:PFM   6->102 PF00338 * Ribosomal_S10 2.4e-43 57.7 97/97  
:BLT:SWISS 1->102 RS10_PLARO 8e-45 76.5 %
:PROS 29->44|PS00361|RIBOSOMAL_S10

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54933.1 GT:GENE ACV54933.1 GT:PRODUCT ribosomal protein S10 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1168858..1169166 GB:FROM 1168858 GB:TO 1169166 GB:DIRECTION + GB:PRODUCT ribosomal protein S10 GB:NOTE TIGRFAM: ribosomal protein S10; PFAM: ribosomal protein S10; KEGG: gbm:Gbem_0932 ribosomal protein S10 GB:PROTEIN_ID ACV54933.1 GB:DB_XREF GI:257474613 InterPro:IPR001848 InterPro:IPR005731 LENGTH 102 SQ:AASEQ MANQKIRIRLKGYDHEIVDQSTKLIVDTAQKTGAKVSGPIPLPTERNLYCVVKGPHVDKDSREQFEMRTHKRLIDILEPTPNTVDSLMRLDLPAGVDIEIKL GT:EXON 1|1-102:0| BL:SWS:NREP 1 BL:SWS:REP 1->102|RS10_PLARO|8e-45|76.5|102/102| PROS 29->44|PS00361|RIBOSOMAL_S10|PDOC00312| BL:PDB:NREP 1 BL:PDB:REP 5->102|1vs5J|3e-34|61.2|98/98| RP:PDB:NREP 1 RP:PDB:REP 4->102|3bbnJ|6e-35|59.6|99/99| RP:PFM:NREP 1 RP:PFM:REP 6->102|PF00338|6e-33|72.2|97/97|Ribosomal_S10| HM:PFM:NREP 1 HM:PFM:REP 6->102|PF00338|2.4e-43|57.7|97/97|Ribosomal_S10| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00338|IPR001848| GO:PFM GO:0005622|"GO:intracellular"|PF00338|IPR001848| GO:PFM GO:0005840|"GO:ribosome"|PF00338|IPR001848| GO:PFM GO:0006412|"GO:translation"|PF00338|IPR001848| RP:SCP:NREP 1 RP:SCP:REP 5->101|1fjgJ|4e-33|56.7|97/98|d.58.15.1| HM:SCP:REP 5->102|1fjgJ_|3.9e-36|62.2|98/0|d.58.15.1|1/1|Ribosomal protein S10| OP:NHOMO 1017 OP:NHOMOORG 996 OP:PATTERN 1111-11111111111111-1-111111-11111111111111111111----111111111111--- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111121111111111111111111111111111-111111111111-2-111111111111111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111-111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ----111--------1--------------------------------------------------111-11---111111--------1-------------112------2---------------------------------------------------------3---211117111113123-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 102 STR:RPRED 100.0 SQ:SECSTR cTTcccEEEEEEccHHHHHHHTTHHHHTTTTTcccEEEEEEcccEEEEEcccccccccccccccEEEEEEEEEEEEccccHHHHHHHTTcccccccEEEEEc DISOP:02AL 102-103| PSIPRED ccEEEEEEEEEEccHHHHHHHHHHHHHHHHHcccEEEccccccccEEEEEEEcccccccccHHHHHEEEEEEEEEEEcccHHHHHHHHccccccccEEEEEc //