[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54946.1
DDBJ      :             Holliday junction DNA helicase RuvB
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  890/915 : Eukaryota  28/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.37.1
:351 amino acids
:PSIPRED
:BLT:PDB   37->348 1ixsB PDBj 3e-94 56.4 %
:RPS:PDB   48->342 2dhrB PDBj 4e-21 18.0 %
:RPS:SCOP  37->277 1hqcA2  c.37.1.20 * 2e-25 53.0 %
:RPS:SCOP  274->348 1hqcA1  a.4.5.11 * 1e-22 64.0 %
:HMM:SCOP  36->273 1in4A2 c.37.1.20 * 1.9e-55 30.3 %
:HMM:SCOP  274->349 1hqcA1 a.4.5.11 * 4.3e-27 60.5 %
:RPS:PFM   23->254 PF05496 * RuvB_N 3e-78 62.9 %
:RPS:PFM   271->345 PF05491 * RuvB_C 4e-24 60.0 %
:HMM:PFM   22->253 PF05496 * RuvB_N 1.3e-116 67.2 232/234  
:HMM:PFM   271->345 PF05491 * RuvB_C 7e-33 58.7 75/76  
:BLT:SWISS 20->349 RUVB_CLOD6 e-109 58.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54946.1 GT:GENE ACV54946.1 GT:PRODUCT Holliday junction DNA helicase RuvB GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1181037..1182092 GB:FROM 1181037 GB:TO 1182092 GB:DIRECTION + GB:PRODUCT Holliday junction DNA helicase RuvB GB:NOTE KEGG: sfu:Sfum_0993 Holliday junction DNA helicase B; TIGRFAM: Holliday junction DNA helicase RuvB; PFAM: AAA ATPase central domain protein; Holliday junction DNA helicase RuvB domain; magnesium chelatase ChlI subunit; ATPase associated with various cellular activities AAA_5; SMART: AAA ATPase GB:PROTEIN_ID ACV54946.1 GB:DB_XREF GI:257474626 InterPro:IPR000523 InterPro:IPR003593 InterPro:IPR003959 InterPro:IPR004605 InterPro:IPR008823 InterPro:IPR008824 InterPro:IPR011704 LENGTH 351 SQ:AASEQ MFEADAGAGRGDAPPADARSRAVTPTLTEDDLALDRSLRPKRLGDYLGQTKIKESLAILIEAAQARGDVVDHILFSGPPGLGKTTLAAVVANELDANLKTTSGPAIERTGDLAAILTNLEEGDVLFIDEIHRLNRMVEEVLYPALEDFALDIVVGKGPAARSIRLDLPRFTLVGATTRTGLLTGPLRDRFGIAFRLQYYSPEELASIVRRSASILDVAIEEDGALEIARRSRGTPRLANRLLKRVRDWAQVRGDGVIDEDVAAQALSFFEVDALGLDAVDNRILELLAVQFGGRPVGLTTLASALSEDTDTLEDVYEPYLMQQGLLVRTPKGRICTERAYDHLGIKVPSSS GT:EXON 1|1-351:0| BL:SWS:NREP 1 BL:SWS:REP 20->349|RUVB_CLOD6|e-109|58.5|330/339| SEG 4->19|adagagrgdappadar| SEG 171->189|tlvgattrtglltgplrdr| BL:PDB:NREP 1 BL:PDB:REP 37->348|1ixsB|3e-94|56.4|312/315| RP:PDB:NREP 1 RP:PDB:REP 48->342|2dhrB|4e-21|18.0|283/446| RP:PFM:NREP 2 RP:PFM:REP 23->254|PF05496|3e-78|62.9|232/232|RuvB_N| RP:PFM:REP 271->345|PF05491|4e-24|60.0|75/76|RuvB_C| HM:PFM:NREP 2 HM:PFM:REP 22->253|PF05496|1.3e-116|67.2|232/234|RuvB_N| HM:PFM:REP 271->345|PF05491|7e-33|58.7|75/76|RuvB_C| GO:PFM:NREP 7 GO:PFM GO:0006281|"GO:DNA repair"|PF05496|IPR008824| GO:PFM GO:0006310|"GO:DNA recombination"|PF05496|IPR008824| GO:PFM GO:0009378|"GO:four-way junction helicase activity"|PF05496|IPR008824| GO:PFM GO:0003677|"GO:DNA binding"|PF05491|IPR008823| GO:PFM GO:0006281|"GO:DNA repair"|PF05491|IPR008823| GO:PFM GO:0006310|"GO:DNA recombination"|PF05491|IPR008823| GO:PFM GO:0009378|"GO:four-way junction helicase activity"|PF05491|IPR008823| RP:SCP:NREP 2 RP:SCP:REP 37->277|1hqcA2|2e-25|53.0|236/238|c.37.1.20| RP:SCP:REP 274->348|1hqcA1|1e-22|64.0|75/76|a.4.5.11| HM:SCP:REP 36->273|1in4A2|1.9e-55|30.3|238/0|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 274->349|1hqcA1|4.3e-27|60.5|76/76|a.4.5.11|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 1202 OP:NHOMOORG 920 OP:PATTERN -------------------------------------------1---1-------------------- 1111111111111111111-111111111111111111111111111111111111111111121111111111111111122--111222222222--1111222112211111111111111111111111111211122222221121112111222221111121112222222222221111111211111111111111111111111111111111221111112211111111111111111111112122122222211221111121111111111111111111111111111111111111111111111121121111111111121221111212222232222111212212112121222111111111122221111211222222222221-112121122111111111111111111111222111212111111112111211111111111111111111111111111111-11211111111111111111111111111111111111111111111111111121111111122212221111111121-2211121111111221121111112212111211111222222222211122111111122122112222222221222222221-11112------22121212222222222-2222222222222222222222111122222222222222222122222221-111111111111--12111111111122213222232222121121111111111222222211112222111111111111121111111111112111112112131222-12122111111111111211---11-21-11111111111111111211112111112 ----11--------------------------------------------------------111-1-12----1------11212----1-------1------------------------------------------------------3--111----1-1--------1----------1--------2111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccccccccccccccHHHHHHcccccccHHHHHHHHHHccccHHHHccHHHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHcccccEEEEEcHHHccHHHHHHHHHHHHccHHHHHHcccccccccccccccEEEEEEccccccccHHHHHcccEEEEcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccc //