[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54950.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:152 amino acids
:PSIPRED
:DISOPRED
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54950.1 GT:GENE ACV54950.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1186110..1186568 GB:FROM 1186110 GB:TO 1186568 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: hypothetical protein GB:PROTEIN_ID ACV54950.1 GB:DB_XREF GI:257474630 LENGTH 152 SQ:AASEQ MSDEAYEHLADLLDALPALQEKGAMLARARWADRVAQLADERETCASLLESADDRLRQAEERLARAEGVDEAARDDARRAVLHAAALRGFRIAPRQNADRALQDALAASPFDTVADARSARMEPERRQALEAEIAAYQRDYACTLAKCEQGE GT:EXON 1|1-152:0| COIL:NAA 45 COIL:NSEG 1 COIL:REGION 32->76| SEG 9->19|ladlldalpal| SEG 55->89|rlrqaeerlaraegvdeaarddarravlhaaalrg| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 39-39,45-45,53-53,59-59,67-68,73-74,76-76,81-82,87-88,90-90,95-95| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccc //