[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54951.1
DDBJ      :             cold-shock DNA-binding domain protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  677/915 : Eukaryota  65/199 : Viruses  1/175   --->[See Alignment]
b.40.4
:67 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->66 1hzcA PDBj 8e-19 60.0 %
:RPS:PDB   1->66 1c9oA PDBj 4e-18 56.9 %
:RPS:SCOP  1->66 1c9oA  b.40.4.5 * 1e-18 56.9 %
:HMM:SCOP  1->68 2es2A1 b.40.4.5 * 1.9e-22 53.7 %
:RPS:PFM   2->65 PF00313 * CSD 8e-14 63.5 %
:HMM:PFM   1->66 PF00313 * CSD 1.3e-31 53.8 65/67  
:BLT:SWISS 1->67 CSPA_LISMO 1e-21 66.7 %
:PROS 15->33|PS00352|COLD_SHOCK

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54951.1 GT:GENE ACV54951.1 GT:PRODUCT cold-shock DNA-binding domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1186750..1186953 GB:FROM 1186750 GB:TO 1186953 GB:DIRECTION + GB:PRODUCT cold-shock DNA-binding domain protein GB:NOTE PFAM: Cold-shock protein DNA-binding; SMART: Cold shock protein; KEGG: gme:Gmet_1266 cold-shock DNA-binding protein family protein GB:PROTEIN_ID ACV54951.1 GB:DB_XREF GI:257474631 InterPro:IPR002059 InterPro:IPR011129 LENGTH 67 SQ:AASEQ MAEGTVKWFNPEKGYGFISQKDGEDLFVHFSEIKMDGFKTLDEGSAVQFDVTTGQNGKLQASNVTKA GT:EXON 1|1-67:0| BL:SWS:NREP 1 BL:SWS:REP 1->67|CSPA_LISMO|1e-21|66.7|66/66| PROS 15->33|PS00352|COLD_SHOCK|PDOC00304| BL:PDB:NREP 1 BL:PDB:REP 1->66|1hzcA|8e-19|60.0|65/66| RP:PDB:NREP 1 RP:PDB:REP 1->66|1c9oA|4e-18|56.9|65/66| RP:PFM:NREP 1 RP:PFM:REP 2->65|PF00313|8e-14|63.5|63/67|CSD| HM:PFM:NREP 1 HM:PFM:REP 1->66|PF00313|1.3e-31|53.8|65/67|CSD| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF00313|IPR002059| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00313|IPR002059| RP:SCP:NREP 1 RP:SCP:REP 1->66|1c9oA|1e-18|56.9|65/66|b.40.4.5| HM:SCP:REP 1->68|2es2A1|1.9e-22|53.7|67/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 2336 OP:NHOMOORG 745 OP:PATTERN ------------------------------------------------------------------11 553-611222211112211-131122111112223344642223422-1223354212--442-4358861--111111-21411122--------------------21---------------111-2122311-----------1-----------------------------------32122--2123666666666666676213333667211436233333365-33333333333332222236-113311-1-4311334211112561111111--------------1111111111111-11222111312222333323311-1445211-5-1-2-11--11241-3421111121121-33341111132B55B444444522122221111-5537533525312331333455432211132565454332222222222233113--------------11-------------22232154445666566533324467444434557586512444221--------3212323231111111224233-4526-----1----66633465355556155--------------------1---1114433564349B433333332332333333411-121311122245445637557755-66-568555577557755765645444556555544544455555575545555319747876576881122-----6665245462221222111111123422423334445555666656666555511111111124448444444444433333333332222115-----------------11-11----1--------1-------2311122222--- --11------------------1---------------------------1----------------------------------------------------1----5--1213121-111317A1625J3-51A-1-26--32122215-15-42-1--3111------122----1A--1223144-3433----- ---------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEETTTTEEEEEETTEEEEEEEGGGccccccccccTTcEEEEEEEEETTEcEEEEEEEEc PSIPRED ccccEEEEEEccccEEEEEcccccEEEEEEEEEccccccccccccEEEEEEEEcccccEEEEEEEEc //