[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54954.1
DDBJ      :             Haloacid dehalogenase domain protein hydrolase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:269 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   6->194 3d6jA PDBj 2e-09 19.9 %
:RPS:SCOP  6->209 2hszA1  c.108.1.6 * 4e-12 21.9 %
:HMM:SCOP  4->239 1te2A_ c.108.1.6 * 8.2e-23 24.3 %
:HMM:PFM   6->199 PF00702 * Hydrolase 1.7e-10 24.2 178/192  
:BLT:SWISS 141->216 ARP2_DICDI 8e-04 35.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54954.1 GT:GENE ACV54954.1 GT:PRODUCT Haloacid dehalogenase domain protein hydrolase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1189075..1189884 GB:FROM 1189075 GB:TO 1189884 GB:DIRECTION + GB:PRODUCT Haloacid dehalogenase domain protein hydrolase GB:NOTE PFAM: Haloacid dehalogenase domain protein hydrolase; KEGG: pca:Pcar_2947 HAD superfamily hydrolase GB:PROTEIN_ID ACV54954.1 GB:DB_XREF GI:257474634 InterPro:IPR005834 LENGTH 269 SQ:AASEQ MASRTYRAIFFDLDGTLLPMELDEFLGAYFEAIAKFVATRGLDAGSFSAGLKAGIGAMAAHDDERTNFDAFWEAFFSYADRDAAAWNELLAGFYEHDFGAIGAGVVSNPAAARAIEALAAKGYPLVLATMPMFPRRAVEWRLSWAGVDAARFARITSFENSTSVKPKLAYYAENVAACGLAGEDVLMVGNNTVEDLAIQGLGADAFLVTDHLLDPTEGFDLGSVKHGTMEEFAAWAEELPPCADPAQAIDADVVDAAARAAALSRAKEA GT:EXON 1|1-269:0| BL:SWS:NREP 1 BL:SWS:REP 141->216|ARP2_DICDI|8e-04|35.5|76/100| SEG 110->120|aaaraiealaa| SEG 243->268|adpaqaidadvvdaaaraaalsrake| RP:PDB:NREP 1 RP:PDB:REP 6->194|3d6jA|2e-09|19.9|166/206| HM:PFM:NREP 1 HM:PFM:REP 6->199|PF00702|1.7e-10|24.2|178/192|Hydrolase| RP:SCP:NREP 1 RP:SCP:REP 6->209|2hszA1|4e-12|21.9|192/224|c.108.1.6| HM:SCP:REP 4->239|1te2A_|8.2e-23|24.3|218/218|c.108.1.6|1/1|HAD-like| OP:NHOMO 29 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------11-----------------------------------------1--------------------------------------------------------------------------------------------11--------------------1----1---111-1-1111-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 239 STR:RPRED 88.8 SQ:SECSTR cccccccEEEEcccTTTEEcHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHccHHHHTTTTccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHGGGcEEcTTHHHHHHHHHHHTcEEEEEccccccHHHHHHHHHTccTTGGcccEEEcGGGccccTTcTHHHHHHHHHTTccGGGEEEEEccHHHTHHHHHTTcEEEEcTTcccTTccccccccEEEccGGGHHHHHTcc############################## DISOP:02AL 269-270| PSIPRED cccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHcccccccccEEEEEcccccccccHHHHHHHHHHccccHHHEEEEcccHHHHHHHHHcccEEEEEcccccccccccccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcc //