[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54968.1
DDBJ      :             pyridoxamine 5'-phosphate oxidase-related FMN- binding
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:137 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   8->130 2ig6A PDBj 4e-12 32.5 %
:RPS:PDB   7->125 2a2jA PDBj 6e-12 14.3 %
:RPS:SCOP  7->124 2htiA1  b.45.1.1 * 4e-12 21.4 %
:HMM:SCOP  1->124 2arzA1 b.45.1.1 * 1.6e-17 25.6 %
:HMM:PFM   6->83 PF01243 * Pyridox_oxidase 1.8e-12 26.9 78/89  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54968.1 GT:GENE ACV54968.1 GT:PRODUCT pyridoxamine 5'-phosphate oxidase-related FMN- binding GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1207400..1207813) GB:FROM 1207400 GB:TO 1207813 GB:DIRECTION - GB:PRODUCT pyridoxamine 5'-phosphate oxidase-related FMN- binding GB:NOTE PFAM: pyridoxamine 5'-phosphate oxidase-related FMN- binding; KEGG: sew:SeSA_B0050 NimC/NimA family protein GB:PROTEIN_ID ACV54968.1 GB:DB_XREF GI:257474648 InterPro:IPR011576 LENGTH 137 SQ:AASEQ MNGTNTIVDYLTSVPAWYLATCEGDQPHVRPFSFAAVQDGRIWFCTATTKDVYRELELNPKFELTAWKPGSGWVIMRGEAVLEDRANDEVRRAGYEHMTGLGESYEGPDDKTLTFFTVRDPEAWLCDIDGSWNPVEL GT:EXON 1|1-137:0| BL:PDB:NREP 1 BL:PDB:REP 8->130|2ig6A|4e-12|32.5|117/139| RP:PDB:NREP 1 RP:PDB:REP 7->125|2a2jA|6e-12|14.3|119/202| HM:PFM:NREP 1 HM:PFM:REP 6->83|PF01243|1.8e-12|26.9|78/89|Pyridox_oxidase| RP:SCP:NREP 1 RP:SCP:REP 7->124|2htiA1|4e-12|21.4|112/126|b.45.1.1| HM:SCP:REP 1->124|2arzA1|1.6e-17|25.6|121/0|b.45.1.1|1/1|FMN-binding split barrel| OP:NHOMO 23 OP:NHOMOORG 21 OP:PATTERN ---------------------------------1------------1----1---------------- --------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------12-----------111------1---1---11-11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-1----------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 92.7 SQ:SECSTR ###HHHHHTTcccTTEEEEEEEETTEEEEEEEEEEEEETTEEEEEEETTcHHHHHHHHccEEEEEEEGGGTEEEEEEEEEEEccHHHHHHHHHHccHHHHHHHHHccTTccccccHHHHHHHHHHEcccc####### PSIPRED cccHHHHHHHHHcccEEEEEEccccccccEEEEEEEEccccEEEEccccccHHHHHHHcccEEEEEEcccccEEEEEEEEEEEEcccHHHHHHHHcccHHHHHccccccccEEEEEEEEccEEEEEEcccccccEEc //