[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54972.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  65/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:201 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   21->188 PF07155 * DUF1393 1.4e-10 23.6 161/169  
:BLT:SWISS 36->184 YPAA_BACSU 9e-07 25.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54972.1 GT:GENE ACV54972.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1210422..1211027) GB:FROM 1210422 GB:TO 1211027 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: bcr:BCAH187_A1643 hypothetical protein GB:PROTEIN_ID ACV54972.1 GB:DB_XREF GI:257474652 LENGTH 201 SQ:AASEQ MTGNAPGTNAQDTYEFTNTNKWDTRQLVTMALMCAIGVLLSFVEFPLLPGVTWLKYDASAMPAMVCGFAFGPAAGLAVGVVGAVIHGILMADFSGAVMNILVVAGFILPAALVYRRSRTFKSGVVGLVLSAITATVMAILGNLVITPMWLGVPLDAVVAMILPILTPFNLIKAGINAVLTLIVYKSISNLITPKKKQVKGR GT:EXON 1|1-201:0| BL:SWS:NREP 1 BL:SWS:REP 36->184|YPAA_BACSU|9e-07|25.7|148/100| TM:NTM 5 TM:REGION 29->51| TM:REGION 62->84| TM:REGION 92->114| TM:REGION 122->144| TM:REGION 159->181| SEG 67->84|gfafgpaaglavgvvgav| HM:PFM:NREP 1 HM:PFM:REP 21->188|PF07155|1.4e-10|23.6|161/169|DUF1393| OP:NHOMO 67 OP:NHOMOORG 65 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------11111111121----------------------------------------------------------------------------------------------------------11--------------------------------------------11111111111111-11--1-------1-------------------------------------------------------------111--11111121111-11-11111--1-----------11--1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 201-202| PSIPRED ccccccccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHccc //