[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54976.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:229 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   64->176 PF01794 * Ferric_reduct 1.3e-07 16.1 112/125  
:BLT:SWISS 1->223 Y572_TREPA 4e-19 36.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54976.1 GT:GENE ACV54976.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1215356..1216045) GB:FROM 1215356 GB:TO 1216045 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54976.1 GB:DB_XREF GI:257474656 LENGTH 229 SQ:AASEQ MEVLLAILISVLFACALHRQIKRYAVSFYIVAVAVDVLFLSGVLFGVSREFAAAVYPYLTRCLLGFALFALVMYIGALPEGSKARQMLMPIRGELSIIAAILTVGHVANYLGTYLADILSGFAGMSAGMVASFVVSSLLIVLLAALTVTSFNAVKTRMSSDAWKRLQKTAYAFFGLTYAHLVLVLAPTVSSSGQKAAFSIAAYTAIMLVYVALRAATHLRAKRARPATP GT:EXON 1|1-229:0| BL:SWS:NREP 1 BL:SWS:REP 1->223|Y572_TREPA|4e-19|36.0|222/100| TM:NTM 7 TM:REGION 1->21| TM:REGION 25->47| TM:REGION 56->78| TM:REGION 89->111| TM:REGION 122->144| TM:REGION 168->190| TM:REGION 197->219| SEG 130->150|vasfvvssllivllaaltvts| HM:PFM:NREP 1 HM:PFM:REP 64->176|PF01794|1.3e-07|16.1|112/125|Ferric_reduct| OP:NHOMO 17 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------35----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------121-1--1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 229-230| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //