[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54990.1
DDBJ      :             FAD dependent oxidoreductase
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  198/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:570 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   121->149 2ywlA PDBj 6e-06 69.0 %
:BLT:PDB   121->287 2i0zA PDBj 3e-05 24.3 %
:RPS:PDB   118->159 1b37A PDBj 4e-09 35.7 %
:RPS:SCOP  121->287 2gqfA1  c.3.1.8 * 1e-15 19.2 %
:HMM:SCOP  117->570 2gmhA1 c.3.1.2 * 1.1e-25 30.2 %
:RPS:PFM   121->287 PF03486 * HI0933_like 8e-07 33.3 %
:HMM:PFM   121->292 PF07992 * Pyr_redox_2 8.9e-09 24.5 106/202  
:BLT:SWISS 119->568 Y202_CLOB8 7e-92 43.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54990.1 GT:GENE ACV54990.1 GT:PRODUCT FAD dependent oxidoreductase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1235372..1237084 GB:FROM 1235372 GB:TO 1237084 GB:DIRECTION + GB:PRODUCT FAD dependent oxidoreductase GB:NOTE PFAM: FAD dependent oxidoreductase; KEGG: psp:PSPPH_1411 hypothetical protein GB:PROTEIN_ID ACV54990.1 GB:DB_XREF GI:257474670 InterPro:IPR006076 LENGTH 570 SQ:AASEQ MLEVSNVKLPLDAGLPGAAAEALVRAAAAAALGVAGRDVRAVRVLKRSVDARKKRDVHFVATLGVELAEAAEEERALAAAGARGGAGAVVGTQVRRHAPYEPLRVPSCAAGREAGGEPRPIVVGAGPAGLFCALYLARAGLRPLVLERGGDVDERLATVAAFEAGGDLDPQTNIQFGEGGAGTFSDGKLTTNIKNPLARHVLRWFVDAGAPEEILWQAKPHIGTDLLVDVVRTLRRQIEEAGGEVRFHAQLEGLRFEGGALAGVDVRDGRTGVLERVDARRAVLACGHSARDTFAVVHGAGVAMEQKPFSVGVRIEHDQGAVNRAQYGDAAAHPALGAADYKLAVHLPDGRSAYTFCMCPGGEVVCAASEEGGVVVNGMSRFARDGANANAALLVGVGPEDFEGDDPLAGVELQRRMERAAFEAARSAGGEAYQAPAQTVGDFLAGRASAAGASVRPTYARGVAWCDLRACLPGFVADALAEALPLLDRRLRGFADAGAVMTGVETRSSSPVRIVRDDALQARVEGAPDDAPESGLYPCGEGAGYAGGIMSAACDGLRVARALASAFEPR GT:EXON 1|1-570:0| BL:SWS:NREP 1 BL:SWS:REP 119->568|Y202_CLOB8|7e-92|43.1|432/533| SEG 9->45|lpldaglpgaaaealvraaaaaalgvagrdvravrvl| SEG 60->92|vatlgvelaeaaeeeralaaagarggagavvgt| SEG 330->339|aaahpalgaa| SEG 415->432|rrmeraafeaarsaggea| SEG 445->456|agrasaagasvr| SEG 477->492|adalaealplldrrlr| BL:PDB:NREP 2 BL:PDB:REP 121->149|2ywlA|6e-06|69.0|29/178| BL:PDB:REP 121->287|2i0zA|3e-05|24.3|152/416| RP:PDB:NREP 1 RP:PDB:REP 118->159|1b37A|4e-09|35.7|42/459| RP:PFM:NREP 1 RP:PFM:REP 121->287|PF03486|8e-07|33.3|147/394|HI0933_like| HM:PFM:NREP 1 HM:PFM:REP 121->292|PF07992|8.9e-09|24.5|106/202|Pyr_redox_2| RP:SCP:NREP 1 RP:SCP:REP 121->287|2gqfA1|1e-15|19.2|146/253|c.3.1.8| HM:SCP:REP 117->570|2gmhA1|1.1e-25|30.2|192/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 236 OP:NHOMOORG 222 OP:PATTERN --------------------1-----------------1---------1-1-1--------------- ------------------------------------------------------------------------------1113------1111-111-----111-111-1---------------------------------------------1111111111----1--1-----1-------------------------------------------------------------------------------------------------111---------------------------------------------111111111111111111111121111-1111112111--1-11--111---111---------1------------------------------------------------------------1111111111111----------------------------------11-------111111-------1-------111111111---111111111111111-1-1-----------1111-1-1111--1----11111111111111-2----------------------------------1-111-----11----------11-----------------------------------------------------------------------------------------------------------------1----------------------11--1----1111111111111----------1--11111111111------------------111111------------------------------------------------1 ------------------------------------------------------------------------------------------------------------2-------------------------------------------------1-----------2-----1-181111-1111-1111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 268 STR:RPRED 47.0 SQ:SECSTR #######################################################################################################HHHTTccEEEEcccccEEEEcccHHHHHHHHHHHHTTcccEEEEcccccccTTccEcccEEccccHHHHHHHHHHHHTTTcccHHHHHHHHHTHHHHHHHHHHHTTccccEEEccTTccTccHHHHHHHHHHHHHHHTTcEEEccEEEEEEEcTTccEEEEEEEETTTEEEEEEEccEEEEcccccTTcHHHHHHHcGGGTTccccccTTcccHHHHHHHHTTccE##############EEcTTcEEEEEEEETTTcccccTHHHHTTcEEEcTTcccccc######################################################################################################################################################################################### PSIPRED ccEEEEEEEcccccccccccHHHHHHHHHHHHcccHHHEEEEEEEEEEccccccccEEEEEEEEEEEcccHHHHHHHcccccccccccccccccccccccccHHcccccccccccccccEEEEcccHHHHHHHHHHHHccccEEEEEccccccccccccccccccccccccccccccHHHcccccccEEEHHcccccHHHHHHHHHHccccccEEEccccccccccHHHHHHHHHHHHHHcccEEEcccEEEEEEEEccEEEEEEEccccccccEEEEccEEEEcccccHHHHHHHHHHcccEEccccEEEEEEEEccHHHHHHHHccccccccEEccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEcccccccccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccccccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEEccEEEEcccccEEEccccccccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHccc //