[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54994.1
DDBJ      :             methylated-DNA/protein- cysteinemethyltransferase
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  234/915 : Eukaryota  21/199 : Viruses  0/175   --->[See Alignment]
a.4.2
:132 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->89 3gx4X PDBj 2e-13 40.5 %
:RPS:PDB   1->95 1eh6A PDBj 8e-21 32.6 %
:RPS:SCOP  3->93 1eh6A1  a.4.2.1 * 7e-25 34.1 %
:HMM:SCOP  1->91 1qntA1 a.4.2.1 * 2.2e-22 48.2 %
:RPS:PFM   4->89 PF01035 * DNA_binding_1 1e-14 55.0 %
:HMM:PFM   3->91 PF01035 * DNA_binding_1 9.1e-27 48.2 83/85  
:BLT:SWISS 4->105 YBAZ_SHIFL 1e-13 41.5 %
:PROS 56->62|PS00374|MGMT

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54994.1 GT:GENE ACV54994.1 GT:PRODUCT methylated-DNA/protein- cysteinemethyltransferase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1238628..1239026) GB:FROM 1238628 GB:TO 1239026 GB:DIRECTION - GB:PRODUCT methylated-DNA/protein- cysteinemethyltransferase GB:NOTE TIGRFAM: methylated-DNA/protein-cysteine methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine S- methyltransferase DNA binding; KEGG: hypothetical protein GB:PROTEIN_ID ACV54994.1 GB:DB_XREF GI:257474674 InterPro:IPR001497 InterPro:IPR014048 LENGTH 132 SQ:AASEQ MGDFSNRVFEVVRRIPRGKVASYGQVGRLIGAPRSARYVGYALHANPDPGAEVNNIPCHRVVFKDGGLCKGFAFGGPEIQREMLEAEGVAFADDTHVDMDACQWDGHADGTAEGELPTAPPEDFDWARELGE GT:EXON 1|1-132:0| BL:SWS:NREP 1 BL:SWS:REP 4->105|YBAZ_SHIFL|1e-13|41.5|94/129| PROS 56->62|PS00374|MGMT|PDOC00320| BL:PDB:NREP 1 BL:PDB:REP 1->89|3gx4X|2e-13|40.5|84/108| RP:PDB:NREP 1 RP:PDB:REP 1->95|1eh6A|8e-21|32.6|89/168| RP:PFM:NREP 1 RP:PFM:REP 4->89|PF01035|1e-14|55.0|80/85|DNA_binding_1| HM:PFM:NREP 1 HM:PFM:REP 3->91|PF01035|9.1e-27|48.2|83/85|DNA_binding_1| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01035|IPR014048| GO:PFM GO:0006281|"GO:DNA repair"|PF01035|IPR014048| RP:SCP:NREP 1 RP:SCP:REP 3->93|1eh6A1|7e-25|34.1|85/90|a.4.2.1| HM:SCP:REP 1->91|1qntA1|2.2e-22|48.2|85/0|a.4.2.1|1/1|Methylated DNA-protein cysteine methyltransferase, C-terminal domain| OP:NHOMO 267 OP:NHOMOORG 258 OP:PATTERN 11------------------------------------------------------------1----- --1-----------1------1----------1---1--------1-----------------1--1---1-------11131-----111--1--1----1111--121--------------------1---1111111111-11--1---1111111-1---11-----1-----1---------1----1---------------1---1---------2-111111-1---------------------1--------1----------------------1--------------------------1-------------1-------1-1--11----2-1---11--112-1111--111-------1---------11-------1------------1---1--1-1--------------1---------------1--------1-------------------------------------1----1----------1------11--------1--2-----1---------------------------------1-----1---1----12--------11-1-1------11-11-1----111-----------------1--11-1--------1------------------111-11-1111111111-111111111111111111111111---111111111111111111111111--111111111111-----------------11111111--------11111------------1-11---------------------1-----111---------111--------111111-------------------------------------1--------1-- ------1---------------1-1--------111-----------1--1------11111-1------------------1---11---1-1-------------------------------------------------------------------------------1--1---------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 78.8 SQ:SECSTR ccHHHHHHHHHHHHccTTccEEHHHHHHHTTcTTcHHHHHHHTTcccccTETTcTccGGGEEcTTcccccccTTTcHHHHHHHHHHTTccccccccccHHHHcc############################ DISOP:02AL 132-133| PSIPRED ccHHHHHHHHHHHHcccccEEcHHHHHHHHcccccHHHHHHHHHHcccHHHccccccEEEEEccccccccccccccHHHHHHHHHHcccEEccccEEcHHHHccccccccHHHcccccccccccHHHHHHcc //