[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55009.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:93 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->93 PF06570 * DUF1129 0.00011 23.5 85/205  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55009.1 GT:GENE ACV55009.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1256232..1256513 GB:FROM 1256232 GB:TO 1256513 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV55009.1 GB:DB_XREF GI:257474689 LENGTH 93 SQ:AASEQ MAVAIVLGALAGAAGFAPLFAGLRMTRRVTDTSNLGHAGALLLGVLLSVAVLFVTAIACALLAREFVLPFVLAEVVALSVAAIGFGVSNLVRK GT:EXON 1|1-93:0| TM:NTM 3 TM:REGION 3->25| TM:REGION 38->60| TM:REGION 68->90| SEG 2->23|avaivlgalagaagfaplfagl| SEG 35->52|lghagalllgvllsvavl| SEG 71->82|vlaevvalsvaa| HM:PFM:NREP 1 HM:PFM:REP 4->93|PF06570|0.00011|23.5|85/205|DUF1129| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-32,34-34,39-40,45-45,48-48,53-53,93-94| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //