[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55014.1
DDBJ      :             ATP synthase F1, alpha subunit
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
a.69.1b.49.1c.37.1
:522 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   28->519 2qe7A PDBj 0.0 70.7 %
:RPS:PDB   30->497 2ck3E PDBj e-116 23.4 %
:RPS:SCOP  25->99 1bmfA2  b.49.1.1 * 1e-13 50.7 %
:RPS:SCOP  100->383 1bmfD3  c.37.1.11 * 4e-77 26.0 %
:RPS:SCOP  390->517 1bmfA1  a.69.1.1 * 3e-35 43.8 %
:HMM:SCOP  10->99 1mabA2 b.49.1.1 * 2.8e-25 59.3 %
:HMM:SCOP  100->388 1e79A3 c.37.1.11 * 2.5e-102 45.1 %
:HMM:SCOP  389->519 1e79A1 a.69.1.1 * 3e-45 48.1 %
:RPS:PFM   29->97 PF02874 * ATP-synt_ab_N 2e-05 32.3 %
:RPS:PFM   153->381 PF00006 * ATP-synt_ab 3e-21 34.0 %
:RPS:PFM   393->444 PF00306 * ATP-synt_ab_C 2e-05 44.2 %
:HMM:PFM   153->381 PF00006 * ATP-synt_ab 1.6e-68 34.9 215/215  
:HMM:PFM   393->494 PF00306 * ATP-synt_ab_C 1.4e-21 43.3 90/113  
:HMM:PFM   26->97 PF02874 * ATP-synt_ab_N 1.6e-17 36.8 68/69  
:BLT:SWISS 7->517 ATPA_HELMI 0.0 67.1 %
:PROS 372->381|PS00152|ATPASE_ALPHA_BETA
:PROS 465->472|PS01295|ISPD

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55014.1 GT:GENE ACV55014.1 GT:PRODUCT ATP synthase F1, alpha subunit GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1258927..1260495 GB:FROM 1258927 GB:TO 1260495 GB:DIRECTION + GB:PRODUCT ATP synthase F1, alpha subunit GB:NOTE KEGG: bha:BH3756 F0F1 ATP synthase subunit alpha; TIGRFAM: ATP synthase F1, alpha subunit; PFAM: H+transporting two-sector ATPase alpha/beta subunit central region; H+transporting two-sector ATPase alpha/beta subunit domain protein GB:PROTEIN_ID ACV55014.1 GB:DB_XREF GI:257474694 InterPro:IPR000194 InterPro:IPR000793 InterPro:IPR001228 InterPro:IPR004100 InterPro:IPR005294 LENGTH 522 SQ:AASEQ MTEITAQSIDEALRKQLDALNTSVESREVGTVIQIGDGIARVDGLKDAMAGELLEFVGSNGQTVYGMAQNLEEDEVGAVLLGDVTAIKENDQVKTTGRIVEIPSGKEMLGRVVNPLGMPIDGKGPIKAEGMRPVEFKAPGVIQRQPVEEPMQTGILAIDSMIPIGRGQRELIIGDRQTGKTSIAVDAIINQKGKDMICIYVAIGQKASTVAGLVETLEKHGAMEYTIIVNASASDSAPLQYIAPMAGAAIGEYFMYNGENGQPATADNPGRHVLCIYDDLSKQAVAYRQMSLTLRRPPGREAYPGDIFYLHSRLLERAVKMSDEYGAGSLTALPMIETQAGDVSAYIPTNVISITDGQIFLSTDLFFQGQRPAVNVGISVSRVGGSAQVKAMKQVAGTLRLDLASYRELQAFTQFGSDLDKSTQDQLNRGAHMTELLKQGRYVPMPVMDQAMSIYAGAHGYLDDILVSDVVRFRGEFLDFIHASKPEIVEALEKAQKFTDEIETDLNAAIEAFKLQFSPSAS GT:EXON 1|1-522:0| BL:SWS:NREP 1 BL:SWS:REP 7->517|ATPA_HELMI|0.0|67.1|495/502| PROS 372->381|PS00152|ATPASE_ALPHA_BETA|PDOC00137| PROS 465->472|PS01295|ISPD|PDOC00997| BL:PDB:NREP 1 BL:PDB:REP 28->519|2qe7A|0.0|70.7|474/474| RP:PDB:NREP 1 RP:PDB:REP 30->497|2ck3E|e-116|23.4|441/458| RP:PFM:NREP 3 RP:PFM:REP 29->97|PF02874|2e-05|32.3|65/68|ATP-synt_ab_N| RP:PFM:REP 153->381|PF00006|3e-21|34.0|212/212|ATP-synt_ab| RP:PFM:REP 393->444|PF00306|2e-05|44.2|52/106|ATP-synt_ab_C| HM:PFM:NREP 3 HM:PFM:REP 153->381|PF00006|1.6e-68|34.9|215/215|ATP-synt_ab| HM:PFM:REP 393->494|PF00306|1.4e-21|43.3|90/113|ATP-synt_ab_C| HM:PFM:REP 26->97|PF02874|1.6e-17|36.8|68/69|ATP-synt_ab_N| GO:PFM:NREP 9 GO:PFM GO:0015992|"GO:proton transport"|PF02874|IPR004100| GO:PFM GO:0016469|"GO:proton-transporting two-sector ATPase complex"|PF02874|IPR004100| GO:PFM GO:0046034|"GO:ATP metabolic process"|PF02874|IPR004100| GO:PFM GO:0046933|"GO:hydrogen ion transporting ATP synthase activity, rotational mechanism"|PF02874|IPR004100| GO:PFM GO:0046961|"GO:proton-transporting ATPase activity, rotational mechanism"|PF02874|IPR004100| GO:PFM GO:0005524|"GO:ATP binding"|PF00006|IPR000194| GO:PFM GO:0015986|"GO:ATP synthesis coupled proton transport"|PF00306|IPR000793| GO:PFM GO:0016820|"GO:hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances"|PF00306|IPR000793| GO:PFM GO:0033178|"GO:proton-transporting two-sector ATPase complex, catalytic domain"|PF00306|IPR000793| RP:SCP:NREP 3 RP:SCP:REP 25->99|1bmfA2|1e-13|50.7|71/71|b.49.1.1| RP:SCP:REP 100->383|1bmfD3|4e-77|26.0|269/276|c.37.1.11| RP:SCP:REP 390->517|1bmfA1|3e-35|43.8|128/131|a.69.1.1| HM:SCP:REP 10->99|1mabA2|2.8e-25|59.3|86/86|b.49.1.1|1/1|N-terminal domain of alpha and beta subunits of F1 ATP synthase| HM:SCP:REP 100->388|1e79A3|2.5e-102|45.1|277/0|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 389->519|1e79A1|3e-45|48.1|131/131|a.69.1.1|1/1|C-terminal domain of alpha and beta subunits of F1 ATP synthase| OP:NHOMO 3703 OP:NHOMOORG 1171 OP:PATTERN 11212211111111121222222222222222111122111112212612442111122221111211 3333222222222222222-22222222222222222222322232223223232222222231322222222222222222233633332313112111111112122244444443333333443222224224222222222344224422222222222422222222222222222221112244233333333333333333333333333333333335555553322222222222222222222422222222222222222222222222222222422422434242424444444444444422222222233333555555555535335333755433553333333353333333534335333332222535353333433433333333333-4444434444324333445333333233253364663332222222223352363222222222222222322222222222222223333444354446547575446588893834843332233433433332443335433363222222235423333523553335444433333357755553252333323333333333333333343222352333335343534355433343344443222533333133343344343553333233-543344333353523322322244544555555555555555532334334635666665565652242222223555428352222222222222222222222222534434333343333345422222222232225333336543333444444452222223433333322222222235----2-34342323336322643333233343343432 3333233-A5413333345433333343333333333333233343233333322333333344343423333333324434344333-353333333333439CB135274656514133443642736k5-4544423723663412243353B33546A45334544A47445434U3352367BE3953353333 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 522-523| PSIPRED cccccHHHHHHHHHHHHHHccccccEEEEEEEEEEEccEEEEEcccccccEEEEEEEcccccEEEEEEEEEcccEEEEEEcccccccccccEEEEcccccccccccHHcccEEEccccccccccccccccccccccccccHHHccccccHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHccccccEEEEEEEcccHHHHHHHHHHHHccccHHcEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccHHccccccccEEEEEEEccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccccccEEEEEEEEcccccccccHHHHHHHHcccEEEEcHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccc //