[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55035.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:198 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->94 PF10099 * RskA 4.1e-05 24.5 49/175  
:BLT:SWISS 71->164 STAN_DROME 3e-04 26.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55035.1 GT:GENE ACV55035.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1286578..1287174) GB:FROM 1286578 GB:TO 1287174 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: proteophosphoglycan ppg4 GB:PROTEIN_ID ACV55035.1 GB:DB_XREF GI:257474715 LENGTH 198 SQ:AASEQ MDDNRFHAEESLEKRLADAYESMGPDEEARRRMLAELLAASERRAPKRRTARRALVPLAACLALAAGIGVFTYASSLPQPPSSSGMAALTSINDELKSAAPAASDESQSESGAAPSDGDARYPFVTLSSGELLRVALGDDGPLPASPETVGEELERAVATGPDETSSSPCTVFATSDPAHPYAIRYDENGVTYLADPA GT:EXON 1|1-198:0| BL:SWS:NREP 1 BL:SWS:REP 71->164|STAN_DROME|3e-04|26.9|93/100| TM:NTM 1 TM:REGION 54->76| SEG 27->66|eearrrmlaellaaserrapkrrtarralvplaaclalaa| HM:PFM:NREP 1 HM:PFM:REP 25->94|PF10099|4.1e-05|24.5|49/175|RskA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,25-25,39-39,53-53,59-59,67-67,81-81,87-87,90-90,95-95,109-109,115-116,118-118,123-123,198-199| PSIPRED ccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccccccccccHHHHHHHHHHHHHcccccccccHHHcccccccccccccEEEEccccEEEEEEcccccccccHHHHHHHHHHHHHccccccccccEEEEEcccccccEEEEEcccccEEccccc //