[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55040.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:210 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->108 PF08006 * DUF1700 1e-11 45.1 %
:HMM:PFM   1->187 PF08006 * DUF1700 2.6e-22 32.0 175/181  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55040.1 GT:GENE ACV55040.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1292321..1292953) GB:FROM 1292321 GB:TO 1292953 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: bcr:BCAH187_A3487 hypothetical protein GB:PROTEIN_ID ACV55040.1 GB:DB_XREF GI:257474720 LENGTH 210 SQ:AASEQ MNKTEFLDALRHALGKLPSYEVEQSIAFYAEMIDDRIEDGMSEQEAVAALGSVHAIAAQIVAETPPIPKAIAKANTGSRTLNIVLLAILSPIWVTLALAFACMVLAIYLAIWSVVVALWAVVAMLLLCAPIGVFGLAWCAATGFPLSGIWVFGCGLAGAGLGLFSWFGVLAASKGLVNLTHSFARWVKGLFIKLKRNDASPIAPEGAAHV GT:EXON 1|1-210:0| TM:NTM 3 TM:REGION 80->102| TM:REGION 117->139| TM:REGION 151->173| SEG 109->129|laiwsvvvalwavvamlllca| SEG 153->163|gcglagaglgl| RP:PFM:NREP 1 RP:PFM:REP 1->108|PF08006|1e-11|45.1|102/177|DUF1700| HM:PFM:NREP 1 HM:PFM:REP 1->187|PF08006|2.6e-22|32.0|175/181|DUF1700| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 97-97,101-105,109-110,179-179| PSIPRED ccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccccccccccc //