[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55066.1
DDBJ      :             NLP/P60 protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  156/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.3.1
:371 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   272->352 2k1gA PDBj 3e-05 35.8 %
:RPS:SCOP  265->362 2evrA2  d.3.1.16 * 8e-19 22.4 %
:HMM:SCOP  257->363 2evrA2 d.3.1.16 * 5.6e-25 36.8 %
:RPS:PFM   281->357 PF00877 * NLPC_P60 5e-10 49.4 %
:HMM:PFM   281->366 PF00877 * NLPC_P60 2.1e-15 38.1 84/105  
:HMM:PFM   185->270 PF01299 * Lamp 0.00029 24.1 83/304  
:BLT:SWISS 36->100 MUKB_ERWCT 2e-04 32.3 %
:BLT:SWISS 267->363 P54_ENTFC 1e-13 46.9 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55066.1 GT:GENE ACV55066.1 GT:PRODUCT NLP/P60 protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1325563..1326678 GB:FROM 1325563 GB:TO 1326678 GB:DIRECTION + GB:PRODUCT NLP/P60 protein GB:NOTE PFAM: NLP/P60 protein; KEGG: bcy:Bcer98_3731 NLP/P60 protein GB:PROTEIN_ID ACV55066.1 GB:DB_XREF GI:257474746 InterPro:IPR000064 LENGTH 371 SQ:AASEQ MQQQAMRARKGVFAGAVAAALAATLMIPSLAYADPTASEKQAEAQAALASLNSMQSTLNRTSVVYDEALAAQREAEAKRDEAQARIDEANGQIADLQTRLGSRARSMYRTGGSSFLDLLLGATTFQEFSTGWDMLNTLNENDADLVQQTKDLRAEVQEQQAAYAEQQRVAAEKADEALRSKQEAASTMSAMQATYDSLSAEAAELLEQERAAQAAADAAQAQAVVEASARQAQENANASGNVAPGNDPSPSPSPAPSEPSGPSYNPVTGNAIVDRAYGCIGLPYSWGGVGPSSFDCSGLVSYAVTGSFSRWGTTNTFMGMSQVGDPQPGDIATSWGHCGIYIGNGQMIHAPTFGQTVCISPVQGDMIIVRP GT:EXON 1|1-371:0| BL:SWS:NREP 2 BL:SWS:REP 36->100|MUKB_ERWCT|2e-04|32.3|65/1479| BL:SWS:REP 267->363|P54_ENTFC|1e-13|46.9|96/516| COIL:NAA 158 COIL:NSEG 2 COIL:REGION 41->105| COIL:REGION 143->235| SEG 7->23|rarkgvfagavaaalaa| SEG 153->172|raevqeqqaayaeqqrvaae| SEG 196->234|dslsaeaaelleqeraaqaaadaaqaqavveasarqaqe| SEG 248->263|pspspspapsepsgps| BL:PDB:NREP 1 BL:PDB:REP 272->352|2k1gA|3e-05|35.8|81/129| RP:PFM:NREP 1 RP:PFM:REP 281->357|PF00877|5e-10|49.4|77/100|NLPC_P60| HM:PFM:NREP 2 HM:PFM:REP 281->366|PF00877|2.1e-15|38.1|84/105|NLPC_P60| HM:PFM:REP 185->270|PF01299|0.00029|24.1|83/304|Lamp| RP:SCP:NREP 1 RP:SCP:REP 265->362|2evrA2|8e-19|22.4|98/148|d.3.1.16| HM:SCP:REP 257->363|2evrA2|5.6e-25|36.8|106/0|d.3.1.16|1/1|Cysteine proteinases| OP:NHOMO 286 OP:NHOMOORG 157 OP:PATTERN -------------------------------------------------------------------- ----1122222212111----41121-----1134434481125112-2--2-2-1--2212---215632-------1242---------------------------------------------------------------1---------------------------------------------2-31111111111112212-2213111----1--111112-----------------------2-2222-121112222311---111-----------------------------1-----------------543334554242-5111----2-12--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------1-11111121-11111222------------------------111-1--1111111----------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 25.9 SQ:SECSTR ###############################################################################################################################################################################################################################################################################HHHHHHHHTTcccccccccTTcccHHHHHHHHHHHTTcccccccHHGcEEcTTEEEEEEETTTEEEEEEEEETTEEEEEETTTTEEEEccTTccHH#### DISOP:02AL 371-372| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHcccHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEcccccccccccHHHHHHHHHHccccccHHHHHHccccHHHcccccEEEEccEEEEEEEccEEEEcccccccEEEEEcccccccccc //