[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55071.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.41.8
:131 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  94->128 2ayjA1  g.41.8.7 * 3e-04 25.7 %
:RPS:PFM   81->129 PF08996 * zf-DNA_Pol 5e-04 47.2 %
:HMM:PFM   83->101 PF10571 * UPF0547 8.7e-08 47.4 19/26  
:HMM:PFM   109->128 PF10571 * UPF0547 1.2e-06 45.0 20/26  
:BLT:SWISS 81->127 CT012_MOUSE 3e-05 40.4 %
:REPEAT 2|83->105|109->131
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55071.1 GT:GENE ACV55071.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1330819..1331214) GB:FROM 1330819 GB:TO 1331214 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: gsu:GSU1083 hypothetical protein GB:PROTEIN_ID ACV55071.1 GB:DB_XREF GI:257474751 LENGTH 131 SQ:AASEQ MGLFSMSGRKKHRTNQGSGYYQPQGFMGKLGGFVGSFSSSDRKRYGHGYPQQNAQPIPGQAQAAPQAQAQAPRAASAAGALSCPKCSAQVPAGSKFCLECGEKLGGGFCAQCGATLPPSAKFCPECGTPRG GT:EXON 1|1-131:0| BL:SWS:NREP 1 BL:SWS:REP 81->127|CT012_MOUSE|3e-05|40.4|47/778| NREPEAT 1 REPEAT 2|83->105|109->131| SEG 50->80|pqqnaqpipgqaqaapqaqaqapraasaaga| RP:PFM:NREP 1 RP:PFM:REP 81->129|PF08996|5e-04|47.2|36/184|zf-DNA_Pol| HM:PFM:NREP 2 HM:PFM:REP 83->101|PF10571|8.7e-08|47.4|19/26|UPF0547| HM:PFM:REP 109->128|PF10571|1.2e-06|45.0|20/26|UPF0547| GO:PFM:NREP 4 GO:PFM GO:0001882|"GO:nucleoside binding"|PF08996|IPR015088| GO:PFM GO:0003887|"GO:DNA-directed DNA polymerase activity"|PF08996|IPR015088| GO:PFM GO:0005634|"GO:nucleus"|PF08996|IPR015088| GO:PFM GO:0006260|"GO:DNA replication"|PF08996|IPR015088| RP:SCP:NREP 1 RP:SCP:REP 94->128|2ayjA1|3e-04|25.7|35/56|g.41.8.7| OP:NHOMO 11 OP:NHOMOORG 10 OP:PATTERN --------------------1------------------------1---------------------- --------------------------------------------------------------------------------1----------------------------------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------1-------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 13-32,131-132| PSIPRED ccccccccccccccccccccccccccccccccEEEEcccccEEEcccccccccccccHHHHHHHHHcccccccccccccEEEcccccccccccccccHHHccccccccccccccccccccccccccccccc //