[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55079.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->50 PF11437 * Vanabin-2 8.6e-05 21.3 47/94  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55079.1 GT:GENE ACV55079.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1339735..1340025 GB:FROM 1339735 GB:TO 1340025 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV55079.1 GB:DB_XREF GI:257474759 LENGTH 96 SQ:AASEQ MAQCWERRGCDEEMMSRCPHNIPGEPCPADCRFAACTRSTHEVCQDFNKLLNPERDYDAAVKEVCRFCEHFLEHGPGVAERTGEVTRQGNPNRFLL GT:EXON 1|1-96:0| HM:PFM:NREP 1 HM:PFM:REP 3->50|PF11437|8.6e-05|21.3|47/94|Vanabin-2| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 45-46,48-48,53-54,59-60,62-62,67-67,87-87| PSIPRED ccHHHHHccccHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccc //