[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55080.1
DDBJ      :             pyridoxine biosynthesis protein
Swiss-Prot:             

Homologs  Archaea  64/68 : Bacteria  239/915 : Eukaryota  129/199 : Viruses  0/175   --->[See Alignment]
c.1.2
:296 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   7->274 2nv2I PDBj e-100 66.4 %
:RPS:PDB   54->266 3cr8C PDBj 9e-31 13.1 %
:RPS:SCOP  20->273 1znnA1  c.1.2.6 * 3e-34 69.8 %
:HMM:SCOP  20->273 1znnA1 c.1.2.6 * 1.7e-67 35.8 %
:RPS:PFM   8->214 PF01680 * SOR_SNZ 6e-82 77.8 %
:RPS:PFM   194->252 PF05690 * ThiG 3e-07 46.4 %
:HMM:PFM   7->214 PF01680 * SOR_SNZ 3.6e-115 73.6 208/209  
:HMM:PFM   197->257 PF05690 * ThiG 1.1e-09 37.3 59/247  
:BLT:SWISS 7->296 PDXS_STRAW e-123 76.6 %
:PROS 207->225|PS01235|PDXS_SNZ_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55080.1 GT:GENE ACV55080.1 GT:PRODUCT pyridoxine biosynthesis protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1340161..1341051 GB:FROM 1340161 GB:TO 1341051 GB:DIRECTION + GB:PRODUCT pyridoxine biosynthesis protein GB:NOTE TIGRFAM: pyridoxine biosynthesis protein; PFAM: Vitamin B6 biosynthesis protein; thiazole biosynthesis family protein; KEGG: dds:Ddes_1898 pyridoxine biosynthesis protein GB:PROTEIN_ID ACV55080.1 GB:DB_XREF GI:257474760 InterPro:IPR001852 InterPro:IPR008867 LENGTH 296 SQ:AASEQ MAEQAHGTLKVKTGFAEMMKGGVIMDVVNPEQAKIAEDAGAVAVMALERVPADIRAHGGVARMSDPTMIEGIVEAVSIPVMAKCRIGHFVEAQVLQSLGVDFIDESEVLTPADDEYHVNKWDFDVPFVCGARNLGEALRRIAEGAAMIRTKGEPGTGNVVEAVRHMRTVTTDIARIKGLRDEQLFTAAKDLQAPYELVKWVAEHGCLPVVNFSAGGIATPADAALMMQLGCDGVFVGSGIFKSGDPAKRARAIVEATTNYDDPDTIARVSRDLGEAMVGIEISDIPENELMAGRGW GT:EXON 1|1-296:0| BL:SWS:NREP 1 BL:SWS:REP 7->296|PDXS_STRAW|e-123|76.6|290/304| PROS 207->225|PS01235|PDXS_SNZ_1|PDOC00949| BL:PDB:NREP 1 BL:PDB:REP 7->274|2nv2I|e-100|66.4|268/271| RP:PDB:NREP 1 RP:PDB:REP 54->266|3cr8C|9e-31|13.1|206/493| RP:PFM:NREP 2 RP:PFM:REP 8->214|PF01680|6e-82|77.8|207/208|SOR_SNZ| RP:PFM:REP 194->252|PF05690|3e-07|46.4|56/245|ThiG| HM:PFM:NREP 2 HM:PFM:REP 7->214|PF01680|3.6e-115|73.6|208/209|SOR_SNZ| HM:PFM:REP 197->257|PF05690|1.1e-09|37.3|59/247|ThiG| GO:PFM:NREP 1 GO:PFM GO:0009228|"GO:thiamin biosynthetic process"|PF05690|IPR008867| RP:SCP:NREP 1 RP:SCP:REP 20->273|1znnA1|3e-34|69.8|245/245|c.1.2.6| HM:SCP:REP 20->273|1znnA1|1.7e-67|35.8|254/0|c.1.2.6|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 484 OP:NHOMOORG 432 OP:PATTERN 1111111111111111-111111111111111-111111111111111111111111111-1111-11 1111111111111111111-1111111111111111112111111111111121211111111111111111111111-11-1---------1-------------------------------1-----------1111111111-------------------------------------1111111-11111111111111111111111111111111111111111111111111111111111111----------------------1-------------11111111111-----------------------1--111111-11---1-111------11-1111111311-1111111-11------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------1-1---------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---11111---1-----------------------------111111111-----------------------------------------------1---------------------------11-1111111--- 11--111-1---211111111111111111111111111111111111111111111111111-111111-11116335211111111-12111111111111111-141-------------------------------------------------111-11--------1-1111A111115363141111121- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 296 STR:RPRED 100.0 SQ:SECSTR ccEETccHHHHHHHcccTTTccEcEEcccHHEGGGTcTTTHHHHHHHHHHHHHcccGGGcccccHHHHHHHHHHHTTccHHHEEEccHHHHHHHHHHHHHEEccHHHHHHHHHHcccTTcccccccccEEEccHHGGGTTccTTcEEEcTTccEEEEEEEEEEEETTEEEEHEEEEEEcccccccTTTTTcccHHHHHHHHHHTTcccEEEEcccccccHHHHHHHHHHHTcEEEEccccccccccHHHHHHHHHHHGGGccGGGEHHHTTcHHHHHcccEcccccEEEEEccccH PSIPRED cccccccHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHcccEEEEEEHHccHHHHHcccccccccHHHHHHHHHHccccEEEEEEHHHHHHHHHHHHHccccccHHHcccccccHHcccHHHcccccccccccHHHHHHHHHccHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHccccEEEEcHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHccccccccccHHHccHHHHHccccc //