[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55093.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:290 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->39 PF03266 * DUF265 1.3e-06 29.7 37/168  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55093.1 GT:GENE ACV55093.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1353273..1354145 GB:FROM 1353273 GB:TO 1354145 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: bcj:BCAL0142 putative flagellar biosynthesis protein GB:PROTEIN_ID ACV55093.1 GB:DB_XREF GI:257474773 LENGTH 290 SQ:AASEQ MLFLLTGDVQIGKTRWLERLAAELSGDGVQVAGVLAPGVWRVREPHEVPGERGLAGEGRFEKLGIDNVLLPGGERVPFARRRDLALAEGSFDPTSQSASAQLAWEIADEAIARVNAHFDRIAAELAAVPAGAPALPGEAGSRGYAPLPVDPAAGMFHVKHSFAQTYVSRETSGAEAGETPADPSTGGSRIVVPADEPDAEGSVTVGAEGGLLVVDELGRLELMRDGGLVSAVALLERGPSARFPHALVVVRDWLCPRAEERFAGAWDGSRMLSPGDDARGLVRASFGLSG GT:EXON 1|1-290:0| SEG 122->140|aaelaavpagapalpgeag| HM:PFM:NREP 1 HM:PFM:REP 3->39|PF03266|1.3e-06|29.7|37/168|DUF265| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-25,67-67,73-73,76-76,81-81,193-193,207-207,213-214,216-216,221-221,235-235| PSIPRED cEEEEEccEEEHHHHHHHHHHHHHccccEEEEEEEcccEEEcccHHHccccccccccccHHHccccEEEEccccccccHHHcccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccEEEEEcccccccccEEEEccccEEEEEccccEEEEEcccHHHHHHHHHccccccccEEEEEEEEcccccHHHHHHccccccccccccccccEEEEEcccccc //