[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55111.1
DDBJ      :             nitroreductase
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  36/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.58.1d.90.1
:263 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   10->52 1durA PDBj 8e-06 39.5 %
:BLT:PDB   78->126 3e39B PDBj 1e-07 36.7 %
:RPS:PDB   5->55 1durA PDBj 7e-09 33.3 %
:RPS:PDB   78->261 1bkjA PDBj 3e-15 18.7 %
:RPS:SCOP  1->55 2v4jB1  d.58.1.5 * 4e-09 21.8 %
:RPS:SCOP  78->261 1bkjA  d.90.1.1 * 6e-16 18.3 %
:HMM:SCOP  2->55 2fug91 d.58.1.5 * 4.8e-13 50.0 %
:HMM:SCOP  76->263 1bkjA_ d.90.1.1 * 3.3e-26 31.2 %
:RPS:PFM   82->222 PF00881 * Nitroreductase 2e-08 32.8 %
:HMM:PFM   83->243 PF00881 * Nitroreductase 1.2e-24 34.5 139/165  
:HMM:PFM   3->20 PF00037 * Fer4 1.1e-05 66.7 18/24  
:HMM:PFM   36->53 PF00037 * Fer4 1e-08 61.1 18/24  
:BLT:SWISS 3->55 Y514_METJA 1e-09 39.6 %
:BLT:SWISS 37->76 NIFJ_ANASP 7e-04 32.5 %
:BLT:SWISS 79->127 Y2267_ARCFU 7e-04 34.7 %
:PROS 38->49|PS00198|4FE4S_FER_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55111.1 GT:GENE ACV55111.1 GT:PRODUCT nitroreductase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1372265..1373056 GB:FROM 1372265 GB:TO 1373056 GB:DIRECTION + GB:PRODUCT nitroreductase GB:NOTE PFAM: nitroreductase; 4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG: gme:Gmet_2995 nitroreductase GB:PROTEIN_ID ACV55111.1 GB:DB_XREF GI:257474791 InterPro:IPR000415 InterPro:IPR001450 InterPro:IPR017900 LENGTH 263 SQ:AASEQ MLVEIDERYCIGCGRCVDDCVGANLEVEGVTARVKGLCILCGHCVAVCPTGAVSIPSYDMADVETCVPAGAAVDPRTMLRVVKSRRSVRDYLPNTIEQDTLRLVLEAGRYTATAKNAQGCRFIVVQDELDEFKRLVWDGIEGMLAPPAADKPRWVKLYKPFLVDARAGRQDFLFRNAPAVAFVAAERADDAGLAAQNMELVAASLGLGALFNGYLCRAAEELPAVKAFLEAEDKPLQICMLLGHPAVSYRRTAPRRAGDFVMK GT:EXON 1|1-263:0| BL:SWS:NREP 3 BL:SWS:REP 3->55|Y514_METJA|1e-09|39.6|53/250| BL:SWS:REP 37->76|NIFJ_ANASP|7e-04|32.5|40/1199| BL:SWS:REP 79->127|Y2267_ARCFU|7e-04|34.7|49/174| PROS 38->49|PS00198|4FE4S_FER_1|PDOC00176| TM:NTM 1 TM:REGION 35->57| SEG 174->195|frnapavafvaaeraddaglaa| BL:PDB:NREP 2 BL:PDB:REP 10->52|1durA|8e-06|39.5|43/55| BL:PDB:REP 78->126|3e39B|1e-07|36.7|49/170| RP:PDB:NREP 2 RP:PDB:REP 5->55|1durA|7e-09|33.3|51/55| RP:PDB:REP 78->261|1bkjA|3e-15|18.7|166/230| RP:PFM:NREP 1 RP:PFM:REP 82->222|PF00881|2e-08|32.8|137/157|Nitroreductase| HM:PFM:NREP 3 HM:PFM:REP 83->243|PF00881|1.2e-24|34.5|139/165|Nitroreductase| HM:PFM:REP 3->20|PF00037|1.1e-05|66.7|18/24|Fer4| HM:PFM:REP 36->53|PF00037|1e-08|61.1|18/24|Fer4| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00881|IPR000415| RP:SCP:NREP 2 RP:SCP:REP 1->55|2v4jB1|4e-09|21.8|55/69|d.58.1.5| RP:SCP:REP 78->261|1bkjA|6e-16|18.3|169/230|d.90.1.1| HM:SCP:REP 2->55|2fug91|4.8e-13|50.0|54/0|d.58.1.5|1/1|4Fe-4S ferredoxins| HM:SCP:REP 76->263|1bkjA_|3.3e-26|31.2|154/239|d.90.1.1|1/1|FMN-dependent nitroreductase-like| OP:NHOMO 71 OP:NHOMOORG 45 OP:PATTERN ---------------------------------1---------25--1-1121--------------- --------------------------------------------------------------------------------1------------1-------------------------------11-------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------135-------1-1-2----111---------11-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------4-32222-121111---111-22------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ -----------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 251 STR:RPRED 95.4 SQ:SECSTR ##EEEEcTTcccccccGGGcTTccEEcccccEEcTTTcccccHHHHHcTTccEEETTTcccccc##########cccHHHHHHTcccccccccccccHHHHHHHHHHHHTcccGGGcccEEEEEcccHHHHHHHHHTTccTHHHHccEEEcHHHHHHcTTcccccHHHHHcEEHcccccccccHHHHHHHHHHHHHHHHHHHHHTTcEEEEEGGGGGGGGGHHHHHHHTTccTTEEEEEEEEEcccccccccccccHHHHccc PSIPRED cEEEEcHHHcccccHHHHHcccccEEEcccccEEcccccccccHHHHccccEEEEEcccccHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccEEcccccEEEEEEcHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHccccccEEEEEEEEEccccccccccccccHHHHHc //