[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55125.1
DDBJ      :             CrcB protein
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  283/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:131 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->114 PF02537 * CRCB 6e-11 42.3 %
:HMM:PFM   4->115 PF02537 * CRCB 2e-29 40.2 112/117  
:BLT:SWISS 2->119 CRCB_PELLD 4e-21 42.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55125.1 GT:GENE ACV55125.1 GT:PRODUCT CrcB protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1388622..1389017 GB:FROM 1388622 GB:TO 1389017 GB:DIRECTION + GB:PRODUCT CrcB protein GB:NOTE TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB protein; KEGG: ade:Adeh_3483 camphor resistance protein CrcB GB:PROTEIN_ID ACV55125.1 GB:DB_XREF GI:257474805 InterPro:IPR003691 LENGTH 131 SQ:AASEQ MVAVLCVGLGGFIGSVGRYLLGLVPVEGDFPLMTFAVNFAGAVLIGAVFEAATEGSGLPDNAVLFLKTGVCGGFTTFSAFSLETLALLERGKYATGALYACGSVLACLAGVVIGRLAVRGVRAALTGSAAA GT:EXON 1|1-131:0| BL:SWS:NREP 1 BL:SWS:REP 2->119|CRCB_PELLD|4e-21|42.4|118/129| TM:NTM 3 TM:REGION 3->25| TM:REGION 30->52| TM:REGION 95->117| RP:PFM:NREP 1 RP:PFM:REP 4->114|PF02537|6e-11|42.3|111/115|CRCB| HM:PFM:NREP 1 HM:PFM:REP 4->115|PF02537|2e-29|40.2|112/117|CRCB| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF02537|IPR003691| OP:NHOMO 312 OP:NHOMOORG 295 OP:PATTERN ---1--------------------1--1-------11--111--------121--1------------ --1-----------1------------------------1----------------------1---------------1-1---1-1-11-1-------11-1---1------------------1111111111----11----1------1-1--------------1----------------11--1-1-111111111111111--111-1-1-2-1---1-----1--11111111-11111----1---------------------------------1--------------------------1-------------1---------------11---------1---21-----1------1-------------11112121211-22112111111-11-11-1111---11-1-1---11--11--1--1-111-222222221111-1---------------------------------111-----------------------11---------------1------1--1-1-1------------------1----1---1-------1-1--11111-1-------1111--1-1111111----11111--1--1--11-----111111-1111------11---------11----111-11111-11-111111111111-111111-----1111111111111111-1111111--111111111111-----1--1------1----------------11111111----1-----11-------1-1------------------------11----------------------------------------------------------1----1-111-11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 131-132| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //