[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55151.1
DDBJ      :             pentapeptide repeat protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  135/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.80.8
:230 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   73->213 2bm7C PDBj 3e-10 28.1 %
:RPS:PDB   56->227 2bm7C PDBj 7e-19 22.4 %
:RPS:SCOP  49->213 2j8kA1  b.80.8.1 * 4e-20 22.7 %
:HMM:SCOP  48->230 2bm5A1 b.80.8.1 * 1.4e-35 26.0 %
:HMM:PFM   56->81 PF00805 * Pentapeptide 7.3e-05 30.8 26/40  
:HMM:PFM   90->126 PF00805 * Pentapeptide 7.4e-10 21.6 37/40  
:HMM:PFM   167->201 PF00805 * Pentapeptide 0.00017 28.6 35/40  
:BLT:SWISS 57->195 YMO3_ERWST 7e-11 25.2 %
:REPEAT 3|73->107|108->142|148->182
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55151.1 GT:GENE ACV55151.1 GT:PRODUCT pentapeptide repeat protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1416382..1417074 GB:FROM 1416382 GB:TO 1417074 GB:DIRECTION + GB:PRODUCT pentapeptide repeat protein GB:NOTE PFAM: pentapeptide repeat protein; KEGG: bcz:BCZK0979 hypothetical protein GB:PROTEIN_ID ACV55151.1 GB:DB_XREF GI:257474831 InterPro:IPR001646 LENGTH 230 SQ:AASEQ MTESARRSADTRPPRPARPDIPGELTEVDDLAGWIERDNGGDLRVSHVLVRRDAAEGADFSLVELTESRVEGCSFVGCDFDRAMASDVAFSNCDFSNSTFSQANFTRCTFSSCKFTGADLLEAVLSRVEVRDSTFAYASVAKGKLEDVSVRSTDFSGADLAELRQRRVELDDVRFAGTSFFRASLDGVDLSSCRLADIVLSDTMEELRGCSMDLFQAAGIARRLGVNVKD GT:EXON 1|1-230:0| BL:SWS:NREP 1 BL:SWS:REP 57->195|YMO3_ERWST|7e-11|25.2|139/295| NREPEAT 1 REPEAT 3|73->107|108->142|148->182| SEG 4->22|sarrsadtrpprparpdip| BL:PDB:NREP 1 BL:PDB:REP 73->213|2bm7C|3e-10|28.1|139/180| RP:PDB:NREP 1 RP:PDB:REP 56->227|2bm7C|7e-19|22.4|170/180| HM:PFM:NREP 3 HM:PFM:REP 56->81|PF00805|7.3e-05|30.8|26/40|Pentapeptide| HM:PFM:REP 90->126|PF00805|7.4e-10|21.6|37/40|Pentapeptide| HM:PFM:REP 167->201|PF00805|0.00017|28.6|35/40|Pentapeptide| RP:SCP:NREP 1 RP:SCP:REP 49->213|2j8kA1|4e-20|22.7|163/175|b.80.8.1| HM:SCP:REP 48->230|2bm5A1|1.4e-35|26.0|181/0|b.80.8.1|1/1|Pentapeptide repeat-like| OP:NHOMO 156 OP:NHOMOORG 139 OP:PATTERN --------------------------------------------1-----111--------------- --------111---1------1---1------1111-1---2------------------111-1-1-------------1----1--111--1------------11--------------------------------------21-211-------------1-2111----------------------1-----111-21111111---1111---1111111111-2-------------------1--1--------11------1---11-----------------------------------------------111111111111111---11-1----------------1-------------111---------1-----1--------------11-11-11--1---------------------------------------------------------------------------1-------2---1---------1-11-1----1----------------------------------------------------2--------1---------6-----------------------------------------------2----1-2--2------1-----------1--------------------------------------------------------2----------11111111111-------------------------------------------11------------------------------1-----1----11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 81.7 SQ:SECSTR ######################################ccTTcccTTcccTTcccEccccTTcccTTcEEEccEEEccccTTcccTTcEEEccEEETcEEEccccTTEEEEEEEccccEEEccccccEEEEEEEcTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTccccHHHHHHc##ccTTccccHHHHHHHHHTTTccc## DISOP:02AL 230-231| PSIPRED ccccccccccccccccccccccHHHcccccccccccccccccccEEccccccccccccccccccccccEEccccccccccccccccccEEcccccccccccccEEcccEEcccccccccccccEEccccccccccccccccccEEcccEEcccccccccccccEEEccEEccccccccEEcccccccccccccEEcccEEHHHHHHccccccccHHHHHHHHHHcccccc //