[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55164.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:198 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   112->193 2jfdD PDBj 7e-04 41.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55164.1 GT:GENE ACV55164.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1431607..1432203 GB:FROM 1431607 GB:TO 1432203 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: Hypothetical protein CBG02561 GB:PROTEIN_ID ACV55164.1 GB:DB_XREF GI:257474844 LENGTH 198 SQ:AASEQ MEKASIGRRLATAALCTCLVAMGIPAAALAQGDPSTGADAPATNDPAEGVSATEAGALAADGLAAGQGEASRSDPVLLASFEDPDPASYDVAAGEDLPNLPGSLLARDDAGGQVAVEGVSWECADADPVAPGTHVFAAVLPAGYEVAPSARLPQVTVNVAAPQAPAPELVAAAPRGGLFRCARERGVGGAPCHLRRRR GT:EXON 1|1-198:0| SEG 8->19|rrlataalctcl| SEG 52->70|ateagalaadglaagqgea| BL:PDB:NREP 1 BL:PDB:REP 112->193|2jfdD|7e-04|41.5|65/399| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 32.8 SQ:SECSTR ###############################################################################################################EEEEEEcccHHHHHHcc##TT#############cEEEEEEETTEEEEEEEHHHHHHHHHHHHHHccc##EEEEcccccccc##### DISOP:02AL 25-25,31-32,34-34,39-40,45-45,48-48,53-53,81-81,87-88,90-90,95-95,165-165,171-171,174-174,198-199| PSIPRED cccHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccccccccccHHHcccHHHcccHHccccccccccccccccEEEEEcccccccccccccccccccccHHHEEccccccEEEEEEEEEEEcccccccccHHHHHHHccccccccccccccEEEEEEccccccccHHHHccccccEEEHHHHcccccccccccccc //