[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55169.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  67/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.5
:224 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   69->182 3edoB PDBj 3e-07 26.1 %
:RPS:PDB   69->195 3edoB PDBj 4e-19 20.6 %
:RPS:SCOP  69->193 1zwkA1  c.23.5.8 * 3e-10 22.7 %
:HMM:SCOP  68->192 1ag9A_ c.23.5.1 * 4e-18 35.0 %
:HMM:PFM   78->192 PF03358 * FMN_red 1e-09 19.2 104/146  
:BLT:SWISS 67->183 WRBA_METEP 1e-04 34.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55169.1 GT:GENE ACV55169.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1438553..1439227 GB:FROM 1438553 GB:TO 1439227 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: mes:Meso_3899 twin-arginine translocation pathway signal GB:PROTEIN_ID ACV55169.1 GB:DB_XREF GI:257474849 LENGTH 224 SQ:AASEQ MRQNGLDRRTFVMGSFGFCMAVLGGGMLAGCVAAEEQVAENDAREQGESGSAESVAPESAPEPAGRVGRALVAVFSYSGTTLSVAERIAEATGADLFRIETTDAYPDDYDAMISQVQREQDEGYLPPIAATVPDWDAYDAVYLGHPIWWGQLPHVMRAFLSQHDLAGKVIVPFSTSSSSGNAEALDAIRELCPAADLREALHLTRGSLPVALDEVQPWIERLGL GT:EXON 1|1-224:0| BL:SWS:NREP 1 BL:SWS:REP 67->183|WRBA_METEP|1e-04|34.2|111/199| BL:PDB:NREP 1 BL:PDB:REP 69->182|3edoB|3e-07|26.1|111/146| RP:PDB:NREP 1 RP:PDB:REP 69->195|3edoB|4e-19|20.6|126/146| HM:PFM:NREP 1 HM:PFM:REP 78->192|PF03358|1e-09|19.2|104/146|FMN_red| RP:SCP:NREP 1 RP:SCP:REP 69->193|1zwkA1|3e-10|22.7|110/169|c.23.5.8| HM:SCP:REP 68->192|1ag9A_|4e-18|35.0|100/0|c.23.5.1|1/1|Flavoproteins| OP:NHOMO 100 OP:NHOMOORG 77 OP:PATTERN --------------------------------1-----2111-11--1--12---------------- -------------------------------------1-----1---------1------------------222--11-12------2221-111--------1-----------------------------------------------------------------------------------11----------------------------------------------------------------4---1-------22---2112--------------------------------------------------111------------11-------1---1--11------1--2-1-12---------------------------------------------1---1-------1----------1-------------------------------------------------------------------------------------------------------------------------------------------------------1-----------2---------1---------------------------------------------------------------------------------------------------------------------------------11111111-11---------------------1-1-------------------1-----------------------------------------------------------3------------------------1----------1------------2-----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 69.6 SQ:SECSTR ###################################################################EcEEEEEcccccHHHHHHHHHHHcTTcEEEEccccTcccccHHHHHHHHHHHTTcccccccccccccGGGccEEEEEEEEETTEEcHHHHHHHHHTTcccEEEEEEEcccccHHHHHHHHHHHHTTTcEccHHTTcEEccccEEHHHHHHHHHHHH# PSIPRED ccccccccHHEEcccHHHHHHHHccHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEEEEccccHHHHHHHHHHHHHccEEEEEEccccccccHHHHHHHHHHHHHcccccccccccccHHHccEEEEEcccccccccHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHccccEEEccEEEEccccHHHHHHHHHHHHHccc //