[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55182.1
DDBJ      :             extracellular solute-binding protein family 3
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  115/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:335 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   46->266 3hv1B PDBj 1e-10 24.7 %
:RPS:PDB   52->270 3delB PDBj 4e-23 17.9 %
:RPS:SCOP  53->267 1gggA  c.94.1.1 * 8e-21 23.9 %
:HMM:SCOP  12->267 2a5sA1 c.94.1.1 * 5.5e-29 25.7 %
:RPS:PFM   57->264 PF00497 * SBP_bac_3 2e-05 24.9 %
:RPS:PFM   271->299 PF01692 * Paramyxo_C 9e-04 44.8 %
:HMM:PFM   53->266 PF00497 * SBP_bac_3 1e-32 29.1 213/225  
:BLT:SWISS 57->267 GLNH_ECOLI 3e-10 28.8 %
:BLT:SWISS 285->333 CASP9_HUMAN 2e-05 40.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55182.1 GT:GENE ACV55182.1 GT:PRODUCT extracellular solute-binding protein family 3 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1454080..1455087 GB:FROM 1454080 GB:TO 1455087 GB:DIRECTION + GB:PRODUCT extracellular solute-binding protein family 3 GB:NOTE PFAM: extracellular solute-binding protein family 3; SMART: extracellular solute-binding protein family 3; KEGG: bph:Bphy_7227 extracellular solute-binding protein GB:PROTEIN_ID ACV55182.1 GB:DB_XREF GI:257474862 InterPro:IPR001638 LENGTH 335 SQ:AASEQ MKRYKTLASCCMAVACMAALLVVLTGCSSQQSYTPPEKTPTLSSPTIGKDGTLRVGVNTDNQPLAGQPSSSSKIVGIDVDVAAALADSFGLKLEVVNVGSDAESALKEGTVDIVMGIDKSDSSTSFWKSDAYLPTAVALFSAPSNTQVPTNVVETKIAAQVSSKSAWAVTNEFDKATFSTTDDLKSAFAELASGQVQYVAADAIIGTYAAHSAGDDVHIVALMQQAGGYGVGVSDANTDLKQAVSEALATLTGNGTIGVIETKWLGTALDLSSTPLTAGATKSTDAGATVASKEPKDESEGENADGDAAPADEGTGAGDEVNAGENAVQPGDVAA GT:EXON 1|1-335:0| BL:SWS:NREP 2 BL:SWS:REP 57->267|GLNH_ECOLI|3e-10|28.8|205/248| BL:SWS:REP 285->333|CASP9_HUMAN|2e-05|40.8|49/416| TM:NTM 1 TM:REGION 7->29| SEG 10->24|ccmavacmaallvvl| BL:PDB:NREP 1 BL:PDB:REP 46->266|3hv1B|1e-10|24.7|215/249| RP:PDB:NREP 1 RP:PDB:REP 52->270|3delB|4e-23|17.9|218/232| RP:PFM:NREP 2 RP:PFM:REP 57->264|PF00497|2e-05|24.9|205/222|SBP_bac_3| RP:PFM:REP 271->299|PF01692|9e-04|44.8|29/203|Paramyxo_C| HM:PFM:NREP 1 HM:PFM:REP 53->266|PF00497|1e-32|29.1|213/225|SBP_bac_3| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 53->267|1gggA|8e-21|23.9|213/220|c.94.1.1| HM:SCP:REP 12->267|2a5sA1|5.5e-29|25.7|245/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 133 OP:NHOMOORG 116 OP:PATTERN --------------------------------1----------------------------------- ------------1------------------------1------1---1-----------------------------2121-------------------------------------------------------------1-----------------------------------------1---------------------------------------------1---------------------1-1-1------11----------1------121---11111111111--------------11---111-1--11-------1-11-22---------1---1---2----11---1--------------------------------------2------1-1-1--11111-1--1--2------1----------------------------------------------------------11---122121--1111112111111223111---11--------------------1------------------1---1-111----------------------------------------------------------------------------------------1-12--1------------------------------11111-------------------1--------1---------------------------1-----------------------------1111---------1---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 236 STR:RPRED 70.4 SQ:SECSTR #############################################HcccccEEEEEEccccTTTEcEEcTTccEEcHHHHHHHHHHHHHTcEEEEEEccGGHHHHHHTTcccEcccccccHHHTTEEEEEEEEEEEcEEEEEEEcccccccGGGcccEEEETTcHHHHHHHHcTTccEEEEccHHHHHHHHHTTcccEEEEcHHHHHHHGGGcTTEEEEccGGGcEEEEEEEEETTcHHHHHHHHHHHHHHHHTTHHHHHHHHTTGGGccHHHHHHHTTcE###################################################### PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHcccEEEEEEcccccEEEEEcccccEEEEHHHHHHHHHHHHccEEEEEEccHHHHHHHHcccEEEEEEcccHHHHHcEEccccEEEccEEEEEEccccccHHHHcccEEEEEccccHHHHHHHHccccEEEEEccHHHHHHHHHcccccEEEEcHHHHHHHHHcccccEEEcccccccccEEEEEEcccHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccccccccccccHHHHccccccccEEEEccccccccccccccccEEEccccccccccccc //