[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55201.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:107 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  45->104 1xy7A_ d.32.1.9 * 0.00012 33.3 %
:HMM:PFM   7->67 PF03294 * Pox_Rap94 6.7e-05 34.5 58/795  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55201.1 GT:GENE ACV55201.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1478265..1478588 GB:FROM 1478265 GB:TO 1478588 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: ftn:FTN_1475 hypothetical protein GB:PROTEIN_ID ACV55201.1 GB:DB_XREF GI:257474881 LENGTH 107 SQ:AASEQ MTATYMHIGIPITEKKPNMIYNEAMKFWVSNVDDYDYKVEYLKFEEGTPFPEELHRRWHVAYAVDDLDRYVDDADRVICDPMDAGPGVRLAFVEKDGAVIELYEDKN GT:EXON 1|1-107:0| SEG 60->77|vayavddldryvddadrv| HM:PFM:NREP 1 HM:PFM:REP 7->67|PF03294|6.7e-05|34.5|58/795|Pox_Rap94| HM:SCP:REP 45->104|1xy7A_|0.00012|33.3|60/0|d.32.1.9|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 106-108| PSIPRED cccEEEEEEccccccccccccccEEEEEEEEccccccEEEEEEEccccccHHHHHHcccEEEEHHHHHHHHccccEEEEccccccccEEEEEEEEcccEEEEEEccc //