[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55209.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:90 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->72 PF04610 * TrbL 5e-05 36.4 44/225  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55209.1 GT:GENE ACV55209.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1484636..1484908 GB:FROM 1484636 GB:TO 1484908 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV55209.1 GB:DB_XREF GI:257474889 LENGTH 90 SQ:AASEQ MNDESERIEQGSHPEREEGNGARTAATALVAFGTLVLLFAAAVVVFLLIAELTRGQWMLAGSAVVVLAFLLWLGNRLVHVAANQNKNPLG GT:EXON 1|1-90:0| TM:NTM 2 TM:REGION 27->49| TM:REGION 56->78| SEG 24->48|taatalvafgtlvllfaaavvvfll| HM:PFM:NREP 1 HM:PFM:REP 25->72|PF04610|5e-05|36.4|44/225|TrbL| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,25-25,31-31,34-34,39-39| PSIPRED cccHHHHHHHcccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccHHHHHHHHHHHcccEEHEEEcccccccc //