[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55227.1
DDBJ      :             cell shape determining protein, MreB/Mrl family
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  747/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:351 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   17->345 1jcgA PDBj 3e-78 47.7 %
:RPS:PDB   14->293 3byhA PDBj 2e-27 12.8 %
:RPS:SCOP  17->154 1jceA1  c.55.1.1 * 1e-25 52.9 %
:RPS:SCOP  155->345 1jceA2  c.55.1.1 * 2e-41 41.4 %
:HMM:SCOP  13->154 1jcfA1 c.55.1.1 * 2.1e-35 36.4 %
:HMM:SCOP  155->350 1jcfA2 c.55.1.1 * 5.2e-41 31.1 %
:RPS:PFM   15->338 PF06723 * MreB_Mbl 9e-85 51.6 %
:HMM:PFM   16->344 PF06723 * MreB_Mbl 1.8e-126 56.9 325/327  
:BLT:SWISS 17->338 MREB_BACSU 4e-79 48.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55227.1 GT:GENE ACV55227.1 GT:PRODUCT cell shape determining protein, MreB/Mrl family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1509877..1510932 GB:FROM 1509877 GB:TO 1510932 GB:DIRECTION + GB:PRODUCT cell shape determining protein, MreB/Mrl family GB:NOTE TIGRFAM: cell shape determining protein, MreB/Mrl family; PFAM: cell shape determining protein MreB/Mrl; KEGG: bba:Bd0211 rod shape-determining protein MreB GB:PROTEIN_ID ACV55227.1 GB:DB_XREF GI:257474907 InterPro:IPR004753 LENGTH 351 SQ:AASEQ MSFLDMFSGLTGQMSTDMAIDLGTANTLVAIPGEGIVVNEPSVVAIEKATHRVLAVGHEAKNMINHTPEAFSAEHPLHDGVVADYDVTEAMISAFISKAAPRKYPWQAKPRIVICIPCGATSVEKRAVFEAAVQAGARQAYLIEEPMAAAMGADLPVTEPTGSMVVDIGGGTTEVAVISLGGIVTSSSLRLAGNRMDEAIAMHLRDLLGIKIGERTAEIIKIKIGSILPFEDGRERDMIISGQDVITEQPKEVTIQSEDVRSALVQPCEEMVVHIKETFKKTNPDLASDIIQNGILLTGGGGLLSGLDRYLTDKLEIPVWTSETALTNVVMGCLKVLETPTALKQTLMRSK GT:EXON 1|1-351:0| BL:SWS:NREP 1 BL:SWS:REP 17->338|MREB_BACSU|4e-79|48.1|320/337| SEG 294->311|gilltggggllsgldryl| BL:PDB:NREP 1 BL:PDB:REP 17->345|1jcgA|3e-78|47.7|327/335| RP:PDB:NREP 1 RP:PDB:REP 14->293|3byhA|2e-27|12.8|273/374| RP:PFM:NREP 1 RP:PFM:REP 15->338|PF06723|9e-85|51.6|320/326|MreB_Mbl| HM:PFM:NREP 1 HM:PFM:REP 16->344|PF06723|1.8e-126|56.9|325/327|MreB_Mbl| GO:PFM:NREP 1 GO:PFM GO:0000902|"GO:cell morphogenesis"|PF06723|IPR004753| RP:SCP:NREP 2 RP:SCP:REP 17->154|1jceA1|1e-25|52.9|136/137|c.55.1.1| RP:SCP:REP 155->345|1jceA2|2e-41|41.4|191/196|c.55.1.1| HM:SCP:REP 13->154|1jcfA1|2.1e-35|36.4|140/140|c.55.1.1|1/1|Actin-like ATPase domain| HM:SCP:REP 155->350|1jcfA2|5.2e-41|31.1|193/0|c.55.1.1|1/1|Actin-like ATPase domain| OP:NHOMO 1129 OP:NHOMOORG 772 OP:PATTERN ------------------------111111111-1--------11111--1111-------111--1- 22221--1111-1-111-------11-----11111-1332222---1---------1----2---2323--------1121111111111111111--111122121111111111111111112212111221322223---22311111121111111111-1311111111111111121--112213343333333333333334444443334443433444445331111111111111111--111232222233322222232-322111---11111111111111111111--111-1--1111111111113433333333333333355333332333344333343333333333312311-1111----------------------------------------1---------------11111111111111111111121111111111-------11111111111111111111223311111222222222221224222221222311111111111111111111111111111-------111111211112222222222313312212221211131111111111111111111112111111111111111111111111111111111111-1-111------11111111111111111-111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111---------1111111111111111111111111111111111111112111121111-----1-1111---111-1---1---3223322232111 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 345 STR:RPRED 98.3 SQ:SECSTR ccHHHHHHHHcTTccccEEEEEcccEEEEEETTcccccEEEEccEEEcccccccccccccccEEGGGTcTcEEEccEEcTEEccHHHHHHHHHHHHHTTEETcccGGGccEEEEEcTTccHHHHHHHHHHHHHHHcccEEEEEEHHHHHHHHcccccEccEEEEEEEEccccEEEEEEETTEEcGGGcEEccHHHHHHHHHHHHHHTcccccccGGGcHHHHHHHHHHHHcccTTcEEEEcTTccEEEEcTHHHHTGGGTTcTTTTTcccccHHHHHHHTTccTTTHHHHHHcEEEEEcGGGGcHHHHHHHHHHHHHTTcEEEcccccHHHHHHHTTccHHHHTT###### PSIPRED ccHHHHHHHHHHHHHHHHEEEccccEEEEEEccccEEcccccEEEEEccccEEEEEEHHHHHHHccccccEEEEEEccccEEccccccHHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHccccccccEEEEEEccccEEEEEEEEEccEEEcccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccEEEEEcccccccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccHHHHHHHHHccc //