[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55240.1
DDBJ      :             transcriptional regulator, BadM/Rrf2 family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  185/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.49.1
:186 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   12->84 2ek5B PDBj 1e-04 19.2 %
:RPS:SCOP  12->98 1f6vA  a.49.1.1 * 1e-07 12.8 %
:HMM:SCOP  5->131 1xd7A_ a.4.5.55 * 2e-28 36.3 %
:RPS:PFM   1->82 PF02082 * Rrf2 3e-08 36.6 %
:HMM:PFM   1->82 PF02082 * Rrf2 4.9e-21 37.8 82/83  
:BLT:SWISS 25->136 Y268_AQUAE 3e-13 29.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55240.1 GT:GENE ACV55240.1 GT:PRODUCT transcriptional regulator, BadM/Rrf2 family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1527164..1527724 GB:FROM 1527164 GB:TO 1527724 GB:DIRECTION + GB:PRODUCT transcriptional regulator, BadM/Rrf2 family GB:NOTE TIGRFAM: transcriptional regulator, Rrf2 family; PFAM: protein of unknown function UPF0074; KEGG: glo:Glov_1241 transcriptional regulator, BadM/Rrf2 family GB:PROTEIN_ID ACV55240.1 GB:DB_XREF GI:257474920 InterPro:IPR000944 LENGTH 186 SQ:AASEQ MDVTRRCDYACRILRAAYKSGEAYVSVSDIAEQEDIPYAFARSIQHDLVKGGLIKTVRGARGGLALNCDPAAVTLLEVLEAVQGPVSISLCVMDPAYCDKQKDCAYNKLWQGADRLLNAYFGAITLKDLIEQGASHPVVEAAMAKAKDSDAVPAAVRCAAQCAAPTPRIAAEAPEADDASACESCA GT:EXON 1|1-186:0| BL:SWS:NREP 1 BL:SWS:REP 25->136|Y268_AQUAE|3e-13|29.5|112/144| SEG 151->165|avpaavrcaaqcaap| SEG 170->184|aaeapeaddasaces| RP:PDB:NREP 1 RP:PDB:REP 12->84|2ek5B|1e-04|19.2|73/108| RP:PFM:NREP 1 RP:PFM:REP 1->82|PF02082|3e-08|36.6|82/83|Rrf2| HM:PFM:NREP 1 HM:PFM:REP 1->82|PF02082|4.9e-21|37.8|82/83|Rrf2| RP:SCP:NREP 1 RP:SCP:REP 12->98|1f6vA|1e-07|12.8|78/91|a.49.1.1| HM:SCP:REP 5->131|1xd7A_|2e-28|36.3|124/127|a.4.5.55|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 254 OP:NHOMOORG 185 OP:PATTERN -------------------------------------------------------------------- -1321-------------------------------------1------------------------1----------113111-1---------------------------------------11112111112-111-11---1-1-----------------1--1-------------1111121---------------------11----------1-1--1----------------------------------------------------------------------------------------------1112233333331311-1111111231--1121--321111321112----1---------------------------------------------1-111-----------------1-11----------------132--------1111------------------11112---------------------------------------------11--------------------1--111---113242112-2322333422212--1--------------------------1111--1-1-11------------------------12-------------------------------------------------1-----------------------------------------------------1-1--111-111--111--11111111-------------------------------1----------------111111111--------------------------------------------------12--111111-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 73 STR:RPRED 39.2 SQ:SECSTR ###########HHHHTcccTTcccccHHHHHHHHTccHHHHHHHHHHHHHHTcEEEETTTEEEcTHHHHHHHHHHHHHHHTHHH###################################################################################################### DISOP:02AL 185-187| PSIPRED ccccHHHHHHHHHHHHHHHccccEEEHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccccccccHHHccHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHcccccccccHHHHHHHHHccccccccccccccccHHHHHHcc //