[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55245.1
DDBJ      :             hydrogenase (NiFe) small subunit HydA
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  251/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.81.1e.19.1
:410 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   64->329 1yq9B PDBj 1e-55 42.5 %
:RPS:PDB   63->330 1e3dA PDBj 1e-49 39.3 %
:RPS:SCOP  19->75 1q16A2  c.81.1.1 * 3e-04 12.0 %
:RPS:SCOP  63->330 1cc1S  e.19.1.1 * 5e-68 37.3 %
:HMM:SCOP  59->324 2frvA_ e.19.1.1 * 3.2e-67 39.1 %
:RPS:PFM   72->217 PF01058 * Oxidored_q6 5e-12 42.6 %
:HMM:PFM   72->219 PF01058 * Oxidored_q6 1.1e-31 40.2 127/131  
:HMM:PFM   19->41 PF10518 * TAT_signal 6.5e-05 43.5 23/26  
:BLT:SWISS 25->329 PHNS_DESGI 2e-61 43.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55245.1 GT:GENE ACV55245.1 GT:PRODUCT hydrogenase (NiFe) small subunit HydA GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1532728..1533960 GB:FROM 1532728 GB:TO 1533960 GB:DIRECTION + GB:PRODUCT hydrogenase (NiFe) small subunit HydA GB:NOTE KEGG: dps:DP0574 Ni/Fe-hydrogenase, small subunit; TIGRFAM: hydrogenase (NiFe) small subunit HydA; PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit GB:PROTEIN_ID ACV55245.1 GB:DB_XREF GI:257474925 InterPro:IPR001821 InterPro:IPR006137 InterPro:IPR006311 LENGTH 410 SQ:AASEQ METEATVSEFQNMLSARGVSRRSFMKLCGAVAVAAGLSELAAPRVAQALEKSVIGATKGKLYPVIWIEGASCTGCTESFAQVETPDAASIVLDMISLNYSETLSAAAGWSMEEAKEQTIEAGNYILVYEGAVLEGWGGQALRVADKPGTEHLIEAAEKANAVVALGSCAVNGGWMGAHPNQAGALGVQAFLKKAGINTPVVNVPGCPANPEWLVAVLADVIFLEKLPALNSEDKPAGIFDQTIHDNCERRGHFENGEFVYKFGSEEEAKGYCLYPLGCRGPQTKANCGVTMWNNRRSWCVQSGAPCIGCCEANPNDPGHNWVEVNTPFYKRHRDLRIGDWMVQPGTIALGITGILAAALVVHGFGMKITGRMDGGADFEKVRGWDAKHPDKSIGKYDEADLNNDDKKEGR GT:EXON 1|1-410:0| BL:SWS:NREP 1 BL:SWS:REP 25->329|PHNS_DESGI|2e-61|43.7|286/288| TM:NTM 2 TM:REGION 23->45| TM:REGION 344->366| SEG 345->359|gtialgitgilaaal| BL:PDB:NREP 1 BL:PDB:REP 64->329|1yq9B|1e-55|42.5|254/260| RP:PDB:NREP 1 RP:PDB:REP 63->330|1e3dA|1e-49|39.3|257/262| RP:PFM:NREP 1 RP:PFM:REP 72->217|PF01058|5e-12|42.6|122/128|Oxidored_q6| HM:PFM:NREP 2 HM:PFM:REP 72->219|PF01058|1.1e-31|40.2|127/131|Oxidored_q6| HM:PFM:REP 19->41|PF10518|6.5e-05|43.5|23/26|TAT_signal| GO:PFM:NREP 4 GO:PFM GO:0008137|"GO:NADH dehydrogenase (ubiquinone) activity"|PF01058|IPR006137| GO:PFM GO:0048038|"GO:quinone binding"|PF01058|IPR006137| GO:PFM GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|PF01058|IPR006137| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01058|IPR006137| RP:SCP:NREP 2 RP:SCP:REP 19->75|1q16A2|3e-04|12.0|50/1074|c.81.1.1| RP:SCP:REP 63->330|1cc1S|5e-68|37.3|255/275|e.19.1.1| HM:SCP:REP 59->324|2frvA_|3.2e-67|39.1|261/261|e.19.1.1|1/1|HydA/Nqo6-like| OP:NHOMO 420 OP:NHOMOORG 260 OP:PATTERN -----11---------1--11--1--------------------------223--------------- 112---1--------1--------12------2111-111-222---------------------111-----------111-3322------1-------1-----------------------1--111-111111121111-1-11-11---------------1111-----------------------------------------------------------------------------------------------------------------------------------------------------------1111111111-11---------------2244--1-1-1--------11----------21324---222-2------------------------------------22-----22222-----------1----3-1---------------------------------1--------------------1-------2---31-----12----2-2----21----------------24-22-212321233312-22123--1121---131111222222121111111213232211-1-------11111-111111111111-----2-1------1-112--2222222222-2222222222222222122---1---13332333333323222-2222222--1------------------------1----111111-------------------1---------------------------1------------------------------2-----------------------------------------------------1-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 271 STR:RPRED 66.1 SQ:SECSTR ###########################################################ccEEEEEEEcccccHHHHHHHTccTTcHHHHHHTTcEEEEcTTTccccHHHHHHHHHHHHTccccEEEEEccEEcTGGGTTcEETTEEHHHHHHHHGGGccEEEEEcHHHHHcGGGGcTTcTTcEEcHHHHHGGHTGTcccEEEccccccHHHHHHHHHHHHTTTccccccTTcccHHHHcccHHHHcTTHHHHHTTccccccccHHHHTTcccGGGTccGGGccccHHHHccTTTTccTGGGTcccccTTcTTHHHHc#THHHHcccTTcc############################################################################### DISOP:02AL 410-411| PSIPRED ccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccEEEEcccHHHHHHHHHHHcccEEEEEccccHHcccccccccccccEEHHHHHHHccccccEEEcccccccHHHHHHHHHHHHHcccccHHcccccccHHccccccccccccccccccccccccccccccccEEEEEcccccccEEccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHccccccccccccHHHHcc //