[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55249.1
DDBJ      :             hydrogenase maturation protease
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  92/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.56.1
:166 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->159 1cfzA PDBj 3e-11 27.6 %
:RPS:PDB   6->166 1cfzA PDBj 6e-24 27.8 %
:RPS:SCOP  6->166 1cfzA  c.56.1.1 * 2e-25 28.5 %
:HMM:SCOP  5->168 1cfzA_ c.56.1.1 * 6.6e-32 34.2 %
:RPS:PFM   26->151 PF01750 * HycI 2e-07 34.1 %
:HMM:PFM   25->152 PF01750 * HycI 2e-22 33.6 125/130  
:BLT:SWISS 7->97 HUPD_THIRO 5e-11 40.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55249.1 GT:GENE ACV55249.1 GT:PRODUCT hydrogenase maturation protease GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1537603..1538103 GB:FROM 1537603 GB:TO 1538103 GB:DIRECTION + GB:PRODUCT hydrogenase maturation protease GB:NOTE TIGRFAM: hydrogenase maturation protease; PFAM: peptidase M52 hydrogen uptake protein; KEGG: sfu:Sfum_2951 hydrogenase expression/formation protein GB:PROTEIN_ID ACV55249.1 GB:DB_XREF GI:257474929 InterPro:IPR000671 LENGTH 166 SQ:AASEQ MGAARRIAVFCVGNKLMLDDGVGPAVYEELLTRYDIPDNVELFDLGCLSLNMIERVREYDVIITVDAVDGTDADPGTVFRFEPDAMARHSGATASLHDLKLVDLFDAAALLGYEAEGLCLGMQVENPSPAVVTVGLTPKVDAALPLLVETVAGELARLGSPLRARA GT:EXON 1|1-166:0| BL:SWS:NREP 1 BL:SWS:REP 7->97|HUPD_THIRO|5e-11|40.0|90/221| SEG 107->121|aaallgyeaeglclg| BL:PDB:NREP 1 BL:PDB:REP 6->159|1cfzA|3e-11|27.6|152/162| RP:PDB:NREP 1 RP:PDB:REP 6->166|1cfzA|6e-24|27.8|158/162| RP:PFM:NREP 1 RP:PFM:REP 26->151|PF01750|2e-07|34.1|123/128|HycI| HM:PFM:NREP 1 HM:PFM:REP 25->152|PF01750|2e-22|33.6|125/130|HycI| GO:PFM:NREP 2 GO:PFM GO:0008047|"GO:enzyme activator activity"|PF01750|IPR000671| GO:PFM GO:0008233|"GO:peptidase activity"|PF01750|IPR000671| RP:SCP:NREP 1 RP:SCP:REP 6->166|1cfzA|2e-25|28.5|158/162|c.56.1.1| HM:SCP:REP 5->168|1cfzA_|6.6e-32|34.2|161/0|c.56.1.1|1/1|HybD-like| OP:NHOMO 96 OP:NHOMOORG 92 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------111-1-1-------------------------------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------1------------------------1------------------------------------------------------------------------1----------------------------------------------------------------------------------------1------------------1-1--1111-11222-1---11----------1---------------------------------------1111-1-1111-1-111--------------1------1111111111-11111-1111111111111--------11111111111-1-11-1111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 99.4 SQ:SECSTR #cccccEEEEEEccTTcGGGGHHHHHHHHHHHHEEccTTEEEEEEETccGGGHHHHccccEEEEEEEcccccccTTcEEEEETTHHHHHHcccccHHHHHHHHHHHHHHTTccccEEEEEEEccccccccccTccccHHHHTTHHHHHHHHHHHHHTTTcccEEGG PSIPRED ccccccEEEEEEcccccccccHHHHHHHHHHHccccccccEEEEccccHHHHHHHHHcccEEEEEEEEccccccccEEEEEcHHHHHHHHcccccHHHccHHHHHHHHHHccccccEEEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccc //