[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55253.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.5
:188 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->27 1bvyF PDBj 1e-04 25.9 %
:RPS:PDB   4->41 2bf4A PDBj 1e-04 34.2 %
:RPS:SCOP  1->26 1tllA2  c.23.5.2 * 7e-05 26.9 %
:RPS:SCOP  2->44 1ag9A  c.23.5.1 * 2e-04 23.3 %
:HMM:SCOP  1->159 1oboA_ c.23.5.1 * 6.1e-16 27.0 %
:HMM:PFM   5->49 PF00258 * Flavodoxin_1 1e-06 37.8 45/143  
:PROS 5->21|PS00201|FLAVODOXIN
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55253.1 GT:GENE ACV55253.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1541404..1541970 GB:FROM 1541404 GB:TO 1541970 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: ccv:CCV52592_0646 flavodoxin family protein GB:PROTEIN_ID ACV55253.1 GB:DB_XREF GI:257474933 InterPro:IPR001226 LENGTH 188 SQ:AASEQ MSTVVVYSSQTGFTKRYAEWLAEELGCQVVSLGDEPRFDASGFDVVVLGGWLHAGGLAGKKWLARAREKHLQTRFVVFAVGATPVEWTDMVEEALAKELPSPEFDDVERFYLRGGFAYERLGLPDKLAMKLFFKMQEKNAAADPRAAEMLEGMRGGFDGTDRAAIAPVAARVRALDAAAVSAGSAERA GT:EXON 1|1-188:0| PROS 5->21|PS00201|FLAVODOXIN|PDOC00178| SEG 45->59|vvvlggwlhagglag| SEG 162->187|raaiapvaarvraldaaavsagsaer| RP:PDB:NREP 2 RP:PDB:REP 1->27|1bvyF|1e-04|25.9|27/152| RP:PDB:REP 4->41|2bf4A|1e-04|34.2|38/645| HM:PFM:NREP 1 HM:PFM:REP 5->49|PF00258|1e-06|37.8|45/143|Flavodoxin_1| RP:SCP:NREP 2 RP:SCP:REP 1->26|1tllA2|7e-05|26.9|26/175|c.23.5.2| RP:SCP:REP 2->44|1ag9A|2e-04|23.3|43/175|c.23.5.1| HM:SCP:REP 1->159|1oboA_|6.1e-16|27.0|159/0|c.23.5.1|1/1|Flavoproteins| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-------1----11----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 44 STR:RPRED 23.4 SQ:SECSTR ccEEEEEEccccHHHHHHHHHHHHHHTHcEEEEEGGGccTTHHH################################################################################################################################################ DISOP:02AL 188-189| PSIPRED ccEEEEEEcccccHHHHHHHHHHHHcccEEEEHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHccccEEEEEEEEccccccccccHHHHHHHHccccccccccEEEEEccccHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccc //