[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55262.1
DDBJ      :             protein of unknown function DUF6 transmembrane
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  171/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:331 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   168->218 2b5fD PDBj 8e-04 29.4 %
:HMM:SCOP  54->161 1s7bA_ f.39.1.1 * 1.4e-07 21.8 %
:HMM:SCOP  208->317 1s7bA_ f.39.1.1 * 9.1e-05 21.9 %
:HMM:PFM   29->157 PF00892 * EamA 3.5e-15 22.6 124/126  
:HMM:PFM   181->309 PF00892 * EamA 1.1e-15 22.6 124/126  
:BLT:SWISS 18->217 YICL_SALTY 6e-27 30.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55262.1 GT:GENE ACV55262.1 GT:PRODUCT protein of unknown function DUF6 transmembrane GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1552591..1553586 GB:FROM 1552591 GB:TO 1553586 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF6 transmembrane GB:NOTE PFAM: protein of unknown function DUF6 transmembrane; KEGG: cha:CHAB381_1617 transporter GB:PROTEIN_ID ACV55262.1 GB:DB_XREF GI:257474942 InterPro:IPR000620 LENGTH 331 SQ:AASEQ MREGIAEGAAVFRRRHLRGVLCALTGAGLWGFSGACAQFLLANYDITPSFITAVRMLGAGAVFLLVLLVRNRAQLAAMLGDRRTLGQLAVFGGVGLFLCQITYTIVIGYTNAGTATVLQTTGIAFVMLFTCVLTRRMPRGREVTGLAAAVIATWLIATQGDPSALYLPLMGLAWGIANGLSVAFYIMYPKKLFARWGSFAVTGIGMFIGGIVAAAVYFSGVALGEPLALPALDAAGAAVFAAFVLVGTFAAFALYLHGVSVVGSVQGSLLGAVEPVSATLFATLWLGTAFTGADLAGCALMIAMIFLVTGEKPNVRQDGAQAVEESHSAKS GT:EXON 1|1-331:0| BL:SWS:NREP 1 BL:SWS:REP 18->217|YICL_SALTY|6e-27|30.2|199/300| TM:NTM 10 TM:REGION 19->41| TM:REGION 54->76| TM:REGION 86->108| TM:REGION 113->134| TM:REGION 141->160| TM:REGION 165->187| TM:REGION 195->217| TM:REGION 228->250| TM:REGION 259->281| TM:REGION 289->310| SEG 57->69|lgagavfllvllv| SEG 220->254|gvalgeplalpaldaagaavfaafvlvgtfaafal| SEG 256->271|lhgvsvvgsvqgsllg| RP:PDB:NREP 1 RP:PDB:REP 168->218|2b5fD|8e-04|29.4|51/230| HM:PFM:NREP 2 HM:PFM:REP 29->157|PF00892|3.5e-15|22.6|124/126|EamA| HM:PFM:REP 181->309|PF00892|1.1e-15|22.6|124/126|EamA| HM:SCP:REP 54->161|1s7bA_|1.4e-07|21.8|101/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 208->317|1s7bA_|9.1e-05|21.9|105/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 228 OP:NHOMOORG 171 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------1111---1131------------------------1------------------------------------------------------------------------------------1-1222222221222212-111-12221--2-----------111111111111111----1-3221123212552212242111212111111111122222222222--------------111111111---11------------11--------------11-------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----------------------------------------------------------------1---11-1111111111-1111111111111111111111-----11-1111111111111-111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 51 STR:RPRED 15.4 SQ:SECSTR #######################################################################################################################################################################cHHHHHHHHHHHHHTTTccccHHHHHHHHHHTTHHHHHHHHHHHHHHHHHH################################################################################################################# DISOP:02AL 330-332| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccc //