[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55266.1
DDBJ      :             transcriptional regulator, MarR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:151 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   17->97 2e1nB PDBj 5e-07 8.6 %
:RPS:SCOP  1->97 1p4xA1  a.4.5.28 * 1e-08 11.3 %
:HMM:SCOP  1->140 2fbkA1 a.4.5.28 * 8.6e-18 28.6 %
:HMM:PFM   32->80 PF01047 * MarR 1.4e-05 27.1 48/59  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55266.1 GT:GENE ACV55266.1 GT:PRODUCT transcriptional regulator, MarR family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1556350..1556805 GB:FROM 1556350 GB:TO 1556805 GB:DIRECTION + GB:PRODUCT transcriptional regulator, MarR family GB:NOTE PFAM: regulatory protein MarR; SMART: regulatory protein MarR; KEGG: asu:Asuc_1626 MarR family transcriptional regulator GB:PROTEIN_ID ACV55266.1 GB:DB_XREF GI:257474946 InterPro:IPR000835 LENGTH 151 SQ:AASEQ MDTRNDRANRKYNNLFRLENELYHDIAVKMGLSDSAFGILYWLDDLGDGCLQRDVCVASGLTKQTVNSSVHKLERTGFVELRVEQGRGTHLHLTEAGRALVEERVRPVAEAETAAFVAMGSRDSEELLRLTHLHLELLREQVEALPYPDGR GT:EXON 1|1-151:0| SEG 98->115|ralveervrpvaeaetaa| SEG 125->140|eellrlthlhlellre| RP:PDB:NREP 1 RP:PDB:REP 17->97|2e1nB|5e-07|8.6|81/112| HM:PFM:NREP 1 HM:PFM:REP 32->80|PF01047|1.4e-05|27.1|48/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 1->97|1p4xA1|1e-08|11.3|97/125|a.4.5.28| HM:SCP:REP 1->140|2fbkA1|8.6e-18|28.6|140/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 64.2 SQ:SECSTR cHHHcccHHHHHHcHHHHHHHHHccccEEccHHHHHHHHHHHHTTccEEHHHHHHcTTEEccHHHHHHHHHHHHHTTcEEEEEEcccEEEEEEcccc###################################################### PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccc //