[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55267.1
DDBJ      :             MATE efflux family protein
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  155/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:446 amino acids
:PSIPRED
:HMM:PFM   23->184 PF01554 * MatE 1.6e-23 25.5 161/162  
:HMM:PFM   248->401 PF01554 * MatE 8.5e-17 15.8 152/162  
:BLT:SWISS 17->435 Y709_METJA 4e-12 26.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55267.1 GT:GENE ACV55267.1 GT:PRODUCT MATE efflux family protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1556802..1558142 GB:FROM 1556802 GB:TO 1558142 GB:DIRECTION + GB:PRODUCT MATE efflux family protein GB:NOTE TIGRFAM: MATE efflux family protein; PFAM: multi antimicrobial extrusion protein MatE; KEGG: bha:BH4045 hypothetical protein GB:PROTEIN_ID ACV55267.1 GB:DB_XREF GI:257474947 InterPro:IPR002528 LENGTH 446 SQ:AASEQ MIVVAIKLSDHFTYGRLVRFALPSIAMMIFTSIYSVVDGLFVSNFAGKEALAAVNLVFPLAMALGSIGFMLGTGGAALVAKTMGEGDAERANRLFSFITIAAAVAGAVLIAVGAAALEPVLLLLGAQGSLLEQGLLYGRILLVALPLFIVQNVFLSFFIAAEKPQVGFAVTVAAGVTNIVLDYLFIAVLGWGIAGAAVATAAGQALAAAVSVAFFARSKTSRLRFMRPAVDFRALGTACVNGSSELMTEVAASVVSMLYNYQLMMLAGADGVAAYGVIMYVNFIFTAVFFGFSMGTGPVVSYHYGAQNRTELKGLFRKSFILVGTTGAAMFAASQLLAAPLVSVFVGYDPELAAMTLHGFRIYAVAFLVCGFNIYGSAFFTALNNGKVSALISFMRTLVFETSTVMLLPIVWGIDGVWSAIIVAEACALVLTMFFLVYLRKPYGYA GT:EXON 1|1-446:0| BL:SWS:NREP 1 BL:SWS:REP 17->435|Y709_METJA|4e-12|26.9|412/450| TM:NTM 11 TM:REGION 21->43| TM:REGION 56->78| TM:REGION 100->122| TM:REGION 138->160| TM:REGION 167->189| TM:REGION 196->217| TM:REGION 268->290| TM:REGION 321->343| TM:REGION 357->379| TM:REGION 389->411| TM:REGION 418->439| SEG 100->117|iaaavagavliavgaaal| SEG 121->136|llllgaqgslleqgll| SEG 166->177|vgfavtvaagvt| SEG 194->216|agaavataagqalaaavsvaffa| SEG 328->339|aamfaasqllaa| HM:PFM:NREP 2 HM:PFM:REP 23->184|PF01554|1.6e-23|25.5|161/162|MatE| HM:PFM:REP 248->401|PF01554|8.5e-17|15.8|152/162|MatE| OP:NHOMO 293 OP:NHOMOORG 167 OP:PATTERN ---------------------------------1--1-22323------1224-------1------- ----------------------------------------------------------------------------111142------33331632-------1--------------------------1---11------------------------------------------------------1---11111111-1111111211--111---1-1-222222----------------------1------2---1122--11----------1--------------------------1------------1-41234444454533-722243432-12-63--33---1---1-----2-------------------------------------------------------1-11---------------------------------1-------------------------------------------------------------------------------------------11--------------1--1------------------------------1-1-11-1111111111-1-----11---------12122--211111121122-----------------------------------------------------------------------------------------------------------------1---1---------------------------------------------------1121111111211-----------------6--------------------------------------------1--111-1--2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //