[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55284.1
DDBJ      :             protein of unknown function DUF1200
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:155 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   74->139 PF06713 * DUF1200 2e-10 39.4 %
:HMM:PFM   74->140 PF06713 * DUF1200 9.4e-15 40.3 67/74  
:HMM:PFM   19->62 PF11911 * DUF3429 0.001 29.3 41/142  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55284.1 GT:GENE ACV55284.1 GT:PRODUCT protein of unknown function DUF1200 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1580727..1581194 GB:FROM 1580727 GB:TO 1581194 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF1200 GB:NOTE PFAM: protein of unknown function DUF1200; KEGG: bat:BAS1151 putative lipoprotein GB:PROTEIN_ID ACV55284.1 GB:DB_XREF GI:257474964 InterPro:IPR009589 LENGTH 155 SQ:AASEQ MGEPMRFAGKVDGWYYALTVGVNVMLAWPLASFFADPAKEGALIGLVVGLLCLVLCDIFIIPTLLRNYVEFDGKGNLLIVFGFQKATYPVSKIRRLRETSNSLASLAASFDRIELRIGYEELMIAVKDKEEFFAEIERRCPQVEIVRRASVSKSR GT:EXON 1|1-155:0| TM:NTM 2 TM:REGION 15->37| TM:REGION 44->66| SEG 45->56|glvvgllclvlc| RP:PFM:NREP 1 RP:PFM:REP 74->139|PF06713|2e-10|39.4|66/74|DUF1200| HM:PFM:NREP 2 HM:PFM:REP 74->140|PF06713|9.4e-15|40.3|67/74|DUF1200| HM:PFM:REP 19->62|PF11911|0.001|29.3|41/142|DUF3429| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 39-39,45-46,48-48,53-53| PSIPRED cccccEEEEccccEEEEEEEEHHHHHHHHHHHHHccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccEEEEEEHHHHHHHccccccccHHHHcccEEEEEEccEEEEEccccHHHHHHHHHHHcccHHHHHHHHHHHcc //