[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55288.1
DDBJ      :             transcriptional regulator, MerR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  407/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:127 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->124 3gp4B PDBj 2e-31 49.2 %
:RPS:PDB   1->121 3d70A PDBj 7e-19 18.3 %
:RPS:SCOP  2->103 1jbgA  a.6.1.3 * 5e-19 22.5 %
:HMM:SCOP  1->114 1q06A_ a.6.1.3 * 3.9e-30 43.0 %
:RPS:PFM   3->39 PF00376 * MerR 3e-04 61.1 %
:RPS:PFM   46->106 PF09278 * MerR-DNA-bind 2e-05 37.7 %
:HMM:PFM   2->39 PF00376 * MerR 1.7e-17 52.6 38/38  
:HMM:PFM   45->105 PF09278 * MerR-DNA-bind 5.6e-12 32.8 61/65  
:BLT:SWISS 1->124 ADHR_BACSU 5e-33 50.8 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55288.1 GT:GENE ACV55288.1 GT:PRODUCT transcriptional regulator, MerR family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1584169..1584552) GB:FROM 1584169 GB:TO 1584552 GB:DIRECTION - GB:PRODUCT transcriptional regulator, MerR family GB:NOTE PFAM: regulatory protein MerR; Transcription regulator MerR DNA binding; SMART: regulatory protein MerR; KEGG: bsu:BSU27000 hypothetical protein GB:PROTEIN_ID ACV55288.1 GB:DB_XREF GI:257474968 InterPro:IPR000551 InterPro:IPR015358 LENGTH 127 SQ:AASEQ MKIAEVSKEYGLSADTLRYYERIGLLPNVTRTASGIRDYSEQDCARVQFVKCMRAASVSIEALIEYMALYDQGDSTLEARKTLLEEQRALVEQRIAEMQAGLDRLNFKIDNYDKTIRDCEKKLRGEA GT:EXON 1|1-127:0| BL:SWS:NREP 1 BL:SWS:REP 1->124|ADHR_BACSU|5e-33|50.8|124/140| COIL:NAA 19 COIL:NSEG 1 COIL:REGION 84->102| BL:PDB:NREP 1 BL:PDB:REP 1->124|3gp4B|2e-31|49.2|124/130| RP:PDB:NREP 1 RP:PDB:REP 1->121|3d70A|7e-19|18.3|115/276| RP:PFM:NREP 2 RP:PFM:REP 3->39|PF00376|3e-04|61.1|36/37|MerR| RP:PFM:REP 46->106|PF09278|2e-05|37.7|61/65|MerR-DNA-bind| HM:PFM:NREP 2 HM:PFM:REP 2->39|PF00376|1.7e-17|52.6|38/38|MerR| HM:PFM:REP 45->105|PF09278|5.6e-12|32.8|61/65|MerR-DNA-bind| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00376|IPR000551| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00376|IPR000551| RP:SCP:NREP 1 RP:SCP:REP 2->103|1jbgA|5e-19|22.5|102/106|a.6.1.3| HM:SCP:REP 1->114|1q06A_|3.9e-30|43.0|114/127|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 619 OP:NHOMOORG 408 OP:PATTERN -------------------------------------------------------------------- -1-12-----11111--11-1-----11111-111123-1-1-121-1----114-1---112-2--2211---------33------------------------------------------------------1-1-----1---1-22-11-1--------1-12-----------------1-1---12-----22----223-3-11121-1----11-55557345-11111111111111-1-1---5-22-2-1-44--33432-113541-1-----2111111111111--------------11---1111---47---11-11-11222----1-----1---112-----1--1-----------4-------1111121-21-11111111114---1-112131---122--31-111123--11221221-2111111112----21--------------------------------3-4-22221222222122222211222222221--1---23--2-32-1--2-11---1---1111111-----1---------1---1--------1------1--------------1------------112221331-----1111-21-1-12111112------1------12111111111111111-1111111111111111111111---1211111111111111112111---1--111111111111--------------111-1111-3-2222----112131--1-2-11221-2-211-14321--------------------1---42--1------------2---------------------2-------------1------------------1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------5---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 97.6 SQ:SECSTR EEHHHHHHHHTccHHHHHHHHHTTccccEEcTTTccEEEcGGGGGHHHHHHHHHHHTccHHHHHHHTTccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccHH### PSIPRED ccHHHHHHHHcccHHHHHHHHHccccccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //