[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55307.1
DDBJ      :             protein of unknown function DUF205
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  428/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:222 amino acids
:PSIPRED
:RPS:PFM   19->206 PF02660 * DUF205 2e-24 42.7 %
:HMM:PFM   13->205 PF02660 * DUF205 3.9e-50 42.0 176/178  
:BLT:SWISS 19->212 Y3020_GEOMG 4e-26 40.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55307.1 GT:GENE ACV55307.1 GT:PRODUCT protein of unknown function DUF205 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1602217..1602885 GB:FROM 1602217 GB:TO 1602885 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF205 GB:NOTE PFAM: protein of unknown function DUF205; KEGG: rpb:RPB_2422 putative glycerol-3-phosphate acyltransferase PlsY GB:PROTEIN_ID ACV55307.1 GB:DB_XREF GI:257474987 InterPro:IPR003811 LENGTH 222 SQ:AASEQ MGDLLVAAGLFVAAFLLGSIPFGLIISKVFYHTDLREHGSGNIGTTNAIRTMGKVGGYAVFVLDFGKGLLSGVLAWAFSMQFLPGGGLEPGALVTYDTMLAVAFLGCVWGHIFCPWLGFKGGKGIAVAVGCLFVTFGWIGACLELLIFIVLVVATKRVSVGSIAAAAACPFFALYFFWGDWLAWLFCTVAGLTVVWAHRENIKRLRAGTESRIGDKGKKKEA GT:EXON 1|1-222:0| BL:SWS:NREP 1 BL:SWS:REP 19->212|Y3020_GEOMG|4e-26|40.9|176/194| TM:NTM 5 TM:REGION 6->28| TM:REGION 57->79| TM:REGION 95->117| TM:REGION 129->151| TM:REGION 169->191| SEG 4->18|llvaaglfvaafllg| SEG 164->177|aaaaacpffalyff| RP:PFM:NREP 1 RP:PFM:REP 19->206|PF02660|2e-24|42.7|171/178|DUF205| HM:PFM:NREP 1 HM:PFM:REP 13->205|PF02660|3.9e-50|42.0|176/178|DUF205| GO:PFM:NREP 1 GO:PFM GO:0005886|"GO:plasma membrane"|PF02660|IPR003811| OP:NHOMO 442 OP:NHOMOORG 429 OP:PATTERN -------------------------------------------------------------------- 111---------------------------------------------------------------------------1111-1--11-----------------11111---------------11111111111-----122--1-1-1111-1111111-1111111111-111111111111111111112222211211111111-111111111121111111111111111111111111111111111111112121111111111111111-11111111111111111111111111111111111111111111111111-----1--1------1--11-11----1--1111-11-2111-1-111111111----1-1-1111-----------1---------11-1-11----1------11-1--1111--111111111-----11-11111---11---------------111111---1-1111------1-------1---------1-1111111-11111-1---1111-11----------111-----111111111111111111111--1-----111--111111111111111----1---------11-------1--1111----1-1----1-1-------1111-1-----------------------------1111-1--1----------------1-------1-111111111111----11111-----1------1-11----1-------------------1------------1------------1--------------------------11111111----------1111---1--11-----1--1-1---11-11111111-1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc //