[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55321.1
DDBJ      :             protein of unknown function DUF322
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  171/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:115 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->111 PF03780 * DUF322 5e-09 36.8 %
:HMM:PFM   7->112 PF03780 * DUF322 1.4e-28 41.9 105/108  
:BLT:SWISS 7->113 YLOU_BACSU 1e-16 32.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55321.1 GT:GENE ACV55321.1 GT:PRODUCT protein of unknown function DUF322 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1618593..1618940 GB:FROM 1618593 GB:TO 1618940 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF322 GB:NOTE PFAM: protein of unknown function DUF322; KEGG: bcb:BCB4264_A3956 hypothetical protein GB:PROTEIN_ID ACV55321.1 GB:DB_XREF GI:257475001 InterPro:IPR005531 LENGTH 115 SQ:AASEQ MNDTIAGNLHVANDVLADMVGNAALECYGVVGMAAPNAADGIAKILPASRLRRGVVVTTTEVGVHVELYVVIEYGTNINTVSQNLVDQVTFALSEYARVPLDGVEVHVQGVKVRK GT:EXON 1|1-115:0| BL:SWS:NREP 1 BL:SWS:REP 7->113|YLOU_BACSU|1e-16|32.7|107/120| SEG 54->67|gvvvtttevgvhve| RP:PFM:NREP 1 RP:PFM:REP 5->111|PF03780|5e-09|36.8|106/107|DUF322| HM:PFM:NREP 1 HM:PFM:REP 7->112|PF03780|1.4e-28|41.9|105/108|DUF322| OP:NHOMO 172 OP:NHOMOORG 171 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1111--------------------------------------------------------------1----------------------------------------1--11-111111111111111111111111111111111111111111-111111111111111111111111111-1-111111111111---11111111111111111111111111111111111111111111111111111111111-111111111--11111-11----21--1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 115-116| PSIPRED cccccccEEEEcHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHccccccccEEEEEcccEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEEEccc //