[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55325.1
DDBJ      :             pantetheine-phosphate adenylyltransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  855/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.26.1
:160 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->156 1h1tA PDBj 2e-42 49.0 %
:RPS:PDB   2->158 1b6tA PDBj 4e-31 48.4 %
:RPS:SCOP  2->158 1b6tA  c.26.1.3 * 9e-32 48.4 %
:HMM:SCOP  1->158 1tfuA_ c.26.1.3 * 3.8e-47 43.3 %
:RPS:PFM   8->134 PF01467 * CTP_transf_2 2e-17 39.4 %
:HMM:PFM   5->133 PF01467 * CTP_transf_2 1.4e-27 35.7 129/157  
:BLT:SWISS 1->157 COAD_THETN 3e-44 50.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55325.1 GT:GENE ACV55325.1 GT:PRODUCT pantetheine-phosphate adenylyltransferase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1623489..1623971 GB:FROM 1623489 GB:TO 1623971 GB:DIRECTION + GB:PRODUCT pantetheine-phosphate adenylyltransferase GB:NOTE KEGG: maq:Maqu_3575 phosphopantetheine adenylyltransferase; TIGRFAM: pantetheine-phosphate adenylyltransferase; cytidyltransferase-related domain protein; PFAM: cytidylyltransferase GB:PROTEIN_ID ACV55325.1 GB:DB_XREF GI:257475005 InterPro:IPR001980 InterPro:IPR004820 InterPro:IPR004821 LENGTH 160 SQ:AASEQ MKRALTPGTFDPITSGHLDVITRAAQLVDEVVVAVAASPKKKPLFSLEERAELVRRATSHLPNVRVEPFDELLVDLAAKLDATVVIKGLRAITDFEYEFQMTALNYQLNQELETLFIMSPPQYMYLSSSIVREIASLHGDVAQFVPACVNEALLKKFGDA GT:EXON 1|1-160:0| BL:SWS:NREP 1 BL:SWS:REP 1->157|COAD_THETN|3e-44|50.3|157/160| SEG 31->37|vvvavaa| BL:PDB:NREP 1 BL:PDB:REP 2->156|1h1tA|2e-42|49.0|155/158| RP:PDB:NREP 1 RP:PDB:REP 2->158|1b6tA|4e-31|48.4|157/157| RP:PFM:NREP 1 RP:PFM:REP 8->134|PF01467|2e-17|39.4|127/145|CTP_transf_2| HM:PFM:NREP 1 HM:PFM:REP 5->133|PF01467|1.4e-27|35.7|129/157|CTP_transf_2| GO:PFM:NREP 2 GO:PFM GO:0009058|"GO:biosynthetic process"|PF01467|IPR004820| GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF01467|IPR004820| RP:SCP:NREP 1 RP:SCP:REP 2->158|1b6tA|9e-32|48.4|157/157|c.26.1.3| HM:SCP:REP 1->158|1tfuA_|3.8e-47|43.3|157/157|c.26.1.3|1/1|Nucleotidylyl transferase| OP:NHOMO 863 OP:NHOMOORG 856 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111-111111111111111111111111---11111111111---------------11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---------------111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111221121111111111111111111111111111111111111111111111111111111111-111111--11111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------1-111------1--11---1112111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 158 STR:RPRED 98.8 SQ:SECSTR ccEEEEEEccTTccHHHHHHHHHHHHHccEEEEEEEccccccccccHHHHHHHHHHHTTTcTTEEEEEEcccHHHHHHHTTccEEEEEccTTccHHHHHHHHHHHHHHcTTcEEEEEcccGGGTTccHHHHHHHHHTTcccGGGccHHHHHHHHHHHc## DISOP:02AL 160-161| PSIPRED cEEEEEccccccccHHHHHHHHHHHHHccEEEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHHcccccEEEEccccccccccHHHHHHHHHccccHHHcccHHHHHHHHHHHccc //