[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55343.1
DDBJ      :             transcriptional regulator, XRE family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:71 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   11->68 1y7yB PDBj 2e-04 29.3 %
:RPS:PDB   7->69 3dnvB PDBj 7e-09 15.9 %
:RPS:SCOP  7->70 2o38A1  a.35.1.13 * 7e-10 20.3 %
:HMM:SCOP  1->69 1y7yA1 a.35.1.3 * 1.6e-12 24.6 %
:HMM:PFM   14->67 PF01381 * HTH_3 5.4e-10 25.9 54/55  
:BLT:SWISS 7->71 CEBA_BACAM 5e-06 29.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55343.1 GT:GENE ACV55343.1 GT:PRODUCT transcriptional regulator, XRE family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1641797..1642012) GB:FROM 1641797 GB:TO 1642012 GB:DIRECTION - GB:PRODUCT transcriptional regulator, XRE family GB:NOTE PFAM: helix-turn-helix domain protein; SMART: helix-turn-helix domain protein; KEGG: bcy:Bcer98_0751 helix-turn-helix domain- containing protein GB:PROTEIN_ID ACV55343.1 GB:DB_XREF GI:257475023 InterPro:IPR001387 LENGTH 71 SQ:AASEQ MKSDGRRIILGKTIKMLREEQHLSQRRFALMVGTNQTHLWQIECGQVSVGIDLLCRIADGLDIKVKDLIDF GT:EXON 1|1-71:0| BL:SWS:NREP 1 BL:SWS:REP 7->71|CEBA_BACAM|5e-06|29.2|65/102| BL:PDB:NREP 1 BL:PDB:REP 11->68|1y7yB|2e-04|29.3|58/66| RP:PDB:NREP 1 RP:PDB:REP 7->69|3dnvB|7e-09|15.9|63/71| HM:PFM:NREP 1 HM:PFM:REP 14->67|PF01381|5.4e-10|25.9|54/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 7->70|2o38A1|7e-10|20.3|64/89|a.35.1.13| HM:SCP:REP 1->69|1y7yA1|1.6e-12|24.6|69/0|a.35.1.3|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 3 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------3------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHHHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHcGGGccHHHHHHHHHHTTcccccccHc PSIPRED ccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHcc //