[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55346.1
DDBJ      :             GCN5-related N-acetyltransferase
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  73/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:168 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   89->159 1gheB PDBj 8e-06 39.7 %
:RPS:PDB   5->160 3dr6A PDBj 6e-16 19.7 %
:RPS:SCOP  2->141 1yr0A1  d.108.1.1 * 8e-19 25.9 %
:HMM:SCOP  1->160 1yreA1 d.108.1.1 * 7.1e-29 33.8 %
:RPS:PFM   89->134 PF00583 * Acetyltransf_1 3e-04 46.7 %
:HMM:PFM   57->135 PF00583 * Acetyltransf_1 5e-14 30.8 78/83  
:BLT:SWISS 9->140 PPR1_SCHPO 4e-11 34.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55346.1 GT:GENE ACV55346.1 GT:PRODUCT GCN5-related N-acetyltransferase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1645578..1646084 GB:FROM 1645578 GB:TO 1646084 GB:DIRECTION + GB:PRODUCT GCN5-related N-acetyltransferase GB:NOTE PFAM: GCN5-related N-acetyltransferase; KEGG: sml:Smlt2386 hypothetical protein GB:PROTEIN_ID ACV55346.1 GB:DB_XREF GI:257475026 InterPro:IPR000182 LENGTH 168 SQ:AASEQ MALEIRPYREEDLAGMIKVWNEVVEAGEAFPQVEPLTMETARAFFAEQTLTTVAAIDDKLFGLYILHPNNVGRCVHVANASYAVASSARGLGLGRELVKDSLAQAARKGFRGLQFNAVVASNEAAIHLYEDLGFTRVGTIPGGFCSILGNFEDMHIYYKDCFGAALPS GT:EXON 1|1-168:0| BL:SWS:NREP 1 BL:SWS:REP 9->140|PPR1_SCHPO|4e-11|34.8|132/209| SEG 75->88|vhvanasyavassa| BL:PDB:NREP 1 BL:PDB:REP 89->159|1gheB|8e-06|39.7|68/167| RP:PDB:NREP 1 RP:PDB:REP 5->160|3dr6A|6e-16|19.7|152/168| RP:PFM:NREP 1 RP:PFM:REP 89->134|PF00583|3e-04|46.7|45/80|Acetyltransf_1| HM:PFM:NREP 1 HM:PFM:REP 57->135|PF00583|5e-14|30.8|78/83|Acetyltransf_1| GO:PFM:NREP 2 GO:PFM GO:0008080|"GO:N-acetyltransferase activity"|PF00583|IPR000182| GO:PFM GO:0008152|"GO:metabolic process"|PF00583|IPR000182| RP:SCP:NREP 1 RP:SCP:REP 2->141|1yr0A1|8e-19|25.9|139/163|d.108.1.1| HM:SCP:REP 1->160|1yreA1|7.1e-29|33.8|154/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 89 OP:NHOMOORG 86 OP:PATTERN -----------------------------------------1-------------------------- --1-1----------------------------------------1---1--1-1-----1------111----------11-------------------------------------------------------------------------11----------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------1-1---------1---------------------------12-1---1-----111111----1---11----------------111--------------------------------------------1-11111----11--------11----------------------1-----1---------------1--------------------------------------------------------------------------------------------1------------------------------------------------------------------------------111111111111---------------1---------------------------------1-----111---1------------------------11---------------1----------------------------------------------------1-- --------------1-----------------------------------------------1------1---1------------11---------1------1---1-2-----------------------------------------------------1----------------------------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 162 STR:RPRED 96.4 SQ:SECSTR EccEEEEccGGGHHHHHHHHHHHHHccTTTTccccccHHHHHHHHHHHHcEEEEEETTEEEEEEEEEEcccGGGTTEEEEEEEEcGGGTTccHHHHHHHHHHHHHHHTTcccEEEEEEETTcHHHHHHHHHTTcEEEEEEEEEETTETTEEEEEEEEEEccc###### PSIPRED ccEEEEEccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHcccccEEEEEEEccEEEEEEEEEEcccccccEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHccccEEEEEEEEcccHHHHHHHHHcccEEEEEEcccEEcccccEEEEEEEEEEcccccccc //