[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55347.1
DDBJ      :             ribosomal protein S16
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  885/915 : Eukaryota  102/199 : Viruses  0/175   --->[See Alignment]
d.27.1
:81 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->77 2j00P PDBj 2e-19 54.7 %
:RPS:PDB   3->77 3bbnP PDBj 3e-28 42.5 %
:RPS:SCOP  3->77 1fjgP  d.27.1.1 * 5e-29 54.7 %
:HMM:SCOP  2->83 1fjgP_ d.27.1.1 * 3.4e-28 65.9 %
:RPS:PFM   9->67 PF00886 * Ribosomal_S16 4e-12 54.2 %
:HMM:PFM   9->67 PF00886 * Ribosomal_S16 2.7e-28 52.5 59/62  
:BLT:SWISS 1->76 RS16_CLOTH 9e-30 71.1 %
:PROS 3->12|PS00732|RIBOSOMAL_S16

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55347.1 GT:GENE ACV55347.1 GT:PRODUCT ribosomal protein S16 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1646403..1646648 GB:FROM 1646403 GB:TO 1646648 GB:DIRECTION + GB:PRODUCT ribosomal protein S16 GB:NOTE TIGRFAM: ribosomal protein S16; PFAM: ribosomal protein S16; KEGG: dal:Dalk_4649 ribosomal protein S16 GB:PROTEIN_ID ACV55347.1 GB:DB_XREF GI:257475027 InterPro:IPR000307 LENGTH 81 SQ:AASEQ MAVKIRLARHGAKKRPYYRIVVADSRCPRDGKFIEEVGRYNPCTEPAMVQFDLEKVDQWIKNGAQPTDTVASLLKRARENA GT:EXON 1|1-81:0| BL:SWS:NREP 1 BL:SWS:REP 1->76|RS16_CLOTH|9e-30|71.1|76/81| PROS 3->12|PS00732|RIBOSOMAL_S16|PDOC00600| BL:PDB:NREP 1 BL:PDB:REP 3->77|2j00P|2e-19|54.7|75/83| RP:PDB:NREP 1 RP:PDB:REP 3->77|3bbnP|3e-28|42.5|73/80| RP:PFM:NREP 1 RP:PFM:REP 9->67|PF00886|4e-12|54.2|59/62|Ribosomal_S16| HM:PFM:NREP 1 HM:PFM:REP 9->67|PF00886|2.7e-28|52.5|59/62|Ribosomal_S16| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00886|IPR000307| GO:PFM GO:0005622|"GO:intracellular"|PF00886|IPR000307| GO:PFM GO:0005840|"GO:ribosome"|PF00886|IPR000307| GO:PFM GO:0006412|"GO:translation"|PF00886|IPR000307| RP:SCP:NREP 1 RP:SCP:REP 3->77|1fjgP|5e-29|54.7|75/83|d.27.1.1| HM:SCP:REP 2->83|1fjgP_|3.4e-28|65.9|82/83|d.27.1.1|1/1|Ribosomal protein S16| OP:NHOMO 1038 OP:NHOMOORG 987 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111-1111111111111111111---11111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-1111111-11----1--1-11111111111111111111111111111111111111111111111111-1111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111-111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111-11111111111111111111111111111111-111111111111111121111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111-111-1111111111111111111111111111 ------------111--11111-1111---------------------111111---1111111--11--1111--1-111------1--------111----112---111212-1-1--11111-11351-121-----111111---11111---1----------1---132112M1122242231231111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 98.8 SQ:SECSTR #cEEEcccccccTTccccccccEETTcccccccccccccccTTccccEccccTTTccccTTcccEEcTTTccccTTTTccc PSIPRED ccEEEEEHHcccccccEEEEEEEEcccccccccEEEcccccccccccEEEEcHHHHHHHHHccccccHHHHHHHHHHHHcc //