[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55351.1
DDBJ      :             signal peptidase I
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  392/915 : Eukaryota  38/199 : Viruses  0/175   --->[See Alignment]
b.87.1d.92.1
:188 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->163 1b12D PDBj 7e-11 40.9 %
:RPS:PDB   38->154 1b12A PDBj 2e-13 22.6 %
:RPS:PDB   134->180 1c7kA PDBj 2e-06 8.5 %
:RPS:SCOP  35->158 1b12A  b.87.1.2 * 8e-16 30.1 %
:RPS:SCOP  134->180 1c7kA  d.92.1.1 * 7e-07 8.5 %
:HMM:SCOP  36->187 1b12A_ b.87.1.2 * 7.1e-43 43.4 %
:RPS:PFM   45->102 PF00717 * Peptidase_S24 3e-07 50.0 %
:RPS:PFM   90->163 PF10502 * Peptidase_S26 2e-09 58.2 %
:HMM:PFM   45->115 PF00717 * Peptidase_S24 7.8e-16 42.4 66/70  
:HMM:PFM   87->177 PF10502 * Peptidase_S26 6.4e-15 33.0 88/138  
:BLT:SWISS 13->51 ATKA_STRAW 4e-04 43.6 %
:BLT:SWISS 38->188 LEP1_SYNY3 1e-22 39.6 %
:PROS 146->159|PS00761|SPASE_I_3
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55351.1 GT:GENE ACV55351.1 GT:PRODUCT signal peptidase I GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1648190..1648756 GB:FROM 1648190 GB:TO 1648756 GB:DIRECTION + GB:PRODUCT signal peptidase I GB:NOTE TIGRFAM: signal peptidase I; PFAM: peptidase S24 and S26 domain protein; KEGG: hypothetical protein; K03100 signal peptidase I GB:PROTEIN_ID ACV55351.1 GB:DB_XREF GI:257475031 InterPro:IPR000223 InterPro:IPR011056 LENGTH 188 SQ:AASEQ MNSGEHAAYQKPGILRRFFGLLAWTGFVALLSWLTFVYVGHAYAVPTGSMEKTIMTGDRVLAEKVSYYLRDPEPGDIVMFEDPDIPGRLLLKRCIAVGGQTVDINDEDGLVYVDGVALREPYTDGLPTYTLASDVSYPYTVPEGMMWMMGDNRTNSQDSRYFGAVSVASAEARSVAVLWPLGDVGLLG GT:EXON 1|1-188:0| BL:SWS:NREP 2 BL:SWS:REP 13->51|ATKA_STRAW|4e-04|43.6|39/554| BL:SWS:REP 38->188|LEP1_SYNY3|1e-22|39.6|144/196| PROS 146->159|PS00761|SPASE_I_3|PDOC00418| SEG 164->177|avsvasaearsvav| BL:PDB:NREP 1 BL:PDB:REP 35->163|1b12D|7e-11|40.9|127/222| RP:PDB:NREP 2 RP:PDB:REP 38->154|1b12A|2e-13|22.6|115/239| RP:PDB:REP 134->180|1c7kA|2e-06|8.5|47/132| RP:PFM:NREP 2 RP:PFM:REP 45->102|PF00717|3e-07|50.0|56/70|Peptidase_S24| RP:PFM:REP 90->163|PF10502|2e-09|58.2|67/101|Peptidase_S26| HM:PFM:NREP 2 HM:PFM:REP 45->115|PF00717|7.8e-16|42.4|66/70|Peptidase_S24| HM:PFM:REP 87->177|PF10502|6.4e-15|33.0|88/138|Peptidase_S26| RP:SCP:NREP 2 RP:SCP:REP 35->158|1b12A|8e-16|30.1|113/239|b.87.1.2| RP:SCP:REP 134->180|1c7kA|7e-07|8.5|47/132|d.92.1.1| HM:SCP:REP 36->187|1b12A_|7.1e-43|43.4|152/247|b.87.1.2|1/1|LexA/Signal peptidase| OP:NHOMO 642 OP:NHOMOORG 430 OP:PATTERN -------------------------------------------------------------------- 3351221111111-11111-11111111111111111211-111--21111-11-2231122-1111335--111122112211-111------------------------------------------1---1-111111112143323331122111-122222222211-1111111-1-1---11--12333334322334423213323442223121122222233----------------111-2--1111-111----11----------1---------------------11--1--111--22---222-1232222222222231133144351411323113311111-1111111--111-11-1------112--11112-----------1---------1111---111-112111-----------------------11----111-1-111----1111-11111111---------------------21111--11111111---1111--111--1----1----1-1---1---------------31111111211111111211211-----112-------------------------------1-1--1--------1-------1--1--11111-------------------------------------------------------------------------------------------1-11111-----11-2-------------------------1-2222111111111-111------------------------22111111111111--1-----------------------------------------------------1-- ----------------------------------------------------------------------------------------------1-------------2--111-2--1---------1---------11--1-----11--11-1112----2---1-------1111611-113347-35--1---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 151 STR:RPRED 80.3 SQ:SECSTR ##################################cccccEEEEEccccTTTTTccTTEEEEEEEcEEEEEcccTTcEEEEEcTTcTTcEEEEEEEEcTTcEEEEEEETTTTEEEEETTccccccccccccEEEcccEEEEEEEEEEcGGGccEEccccHHHHccEEGGGEEEEEEEEEEEccTTc### DISOP:02AL 188-189| PSIPRED cccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEcccccccccccccEEEEEEEEcccccccccEEEEEEcccccccEEEEEEEEccccEEEEEccccEEEEccEEcccccccccccccccccccccEEEcccEEEEEccccccccccccEEEccHHHEEEEEEEEEccHHHHcccc //