[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV55365.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:241 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV55365.1 GT:GENE ACV55365.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1667591..1668316 GB:FROM 1667591 GB:TO 1668316 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: GK10816 gene product from transcript GK10816- RA GB:PROTEIN_ID ACV55365.1 GB:DB_XREF GI:257475045 LENGTH 241 SQ:AASEQ MKEQLKDMARPYAMLFLIALAVAIVGRIGLAVMDLTGTLSYDYISAADVPILDVVCSILTGSALVAFMYAASLAMVVSTAGVALHGLLFARRSEGAGRPATAFLWGWATALAAIVCLLITASGILSAVQVASMSSKLPSLPMLVLALVGFAAFLGTLLGAASMTVCACLARARDEKRAGWNLVLAAFVCGLVVMVLTVGTFSAVNAASINLAAVGAWFAADVVVNLAIMFGMGALVKKGRA GT:EXON 1|1-241:0| TM:NTM 7 TM:REGION 13->35| TM:REGION 44->66| TM:REGION 69->90| TM:REGION 107->129| TM:REGION 144->166| TM:REGION 178->200| TM:REGION 210->232| SEG 132->161|smssklpslpmlvlalvgfaaflgtllgaa| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-25,73-73,76-76,81-81,101-101,151-151,157-157,160-160,165-165,185-185,188-188,193-193| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //